WWW.KNIGA.SELUK.RU

БЕСПЛАТНАЯ ЭЛЕКТРОННАЯ БИБЛИОТЕКА - Книги, пособия, учебники, издания, публикации

 

Pages:   || 2 | 3 |

«5 СПИСОК СОКРАЩЕНИЙ 5 ВВЕДЕНИЕ 6 Глава 1. ОБЗОР ЛИТЕРАТУРЫ 9 1.1. Общая схема терминации трансляции 9 1.2. Факторы терминации трансляции первого класса 11 1.3. Факторы ...»

-- [ Страница 1 ] --

5

СПИСОК СОКРАЩЕНИЙ 5

ВВЕДЕНИЕ 6

Глава 1. ОБЗОР ЛИТЕРАТУРЫ 9

1.1. Общая схема терминации трансляции 9

1.2. Факторы терминации трансляции первого класса 11

1.3. Факторы терминации трансляции первого класса 17 1.4. Декодирование стоп-кодона факторами терминации трансляции первого класса 21 1.5. Гидролиз пептидил-тРНК в пептидилтрансферазном центре 27 1.5.1. Молекулярная анатомия пептидил-трансферазного центра 27 1.5.2. Роль рРНК в реакции гидролиза пептидил-тРНК 29 1.5.2. Роль факторов терминации трансляции первого класса в реакции гидролиза пептидил-тРНК Глава 2. МАТЕРИАЛЫ И МЕТОДЫ ИССЛЕДОВАНИЙ 2.1. Материалы 2.1.1. Штаммы бактерий и плазмиды 2.1.2. Среды 2.1.3. Реактивы 2.1.4. Ферменты 2.1.5. Олигонуклеотиды 2.2. Методы исследований 2.2.1. Выделение плазмидной ДНК из E.coli 2.2.2. Электрофорез ДНК в агарозном геле 2.2.3. Расщепление ДНК эндонуклеазами рестрикции и реакция лигирования ДНК 2.2.4. Трансформация E. coli плазмидной ДНК 2.2.5. Полимеразная цепная реакция (ПЦР) 2.2.6. Сайт-направленный мутагенез методом "мегапраймера" 2.2.7. Очистка фрагментов ДНК в легкоплавкой агарозе 2.2.8. Сверхэкспрессия в E. coli и выделение мутантных форм eRF1 человека 2.2.9. Сверхэкспрессия в E. coli и выделение изолированного М- домена eRF1 человека и его мутантной формы G183A, меченных стабильными изотопами 15N и 13С 2.2.10. Электрофорез белков в денатурирующем 12% ПААГ 2.2.11. Измерение спектров ЯМР и их анализ 2.2.12. Расчет структуры 2.2.13. Анализ динамических свойств 2.2.14. ЯМР-титрование субчастицами рибосом 2.2.15. Определение активности eRF1 Глава 3. РЕЗУЛЬТАТЫ И ИХ ОБСУЖДЕНИЕ 3.1. Определение структуры М-домена eRF1 человека в растворе 3.1.1. Отнесение сигналов атомов основной белковой цепи и боковых цепей аминокислотных остатков M-домена 3.1.2. Определение вторичной и третичной структуры М-домена eRF1 человека 3.1.3. Анализ структуры М-домена eRF1 человека 3.1.4. Влияние замены G183A в М-домене eRF1 3.1.5. Геометрия петли GGQ 3.1.6. Динамика основной цепи М-домена eRF1 3.2. Изучение взаимодействия между М-доменом eRF1 человека и рибосомами эукариот 3.2.1. Определение способности М-домена eRF1 человека специфично связываться с 60S субчастицами рибосом 3.2.2. Аминокислотные остатки M-домена eRF1, формирующие интерфейс взаимодействия белка с 60S субъединицами рибосомы 3.2.3. Влияние замены G183A на связывание М-домена eRF человека с 60S субчастицами рибосом 3.3. Функциональная роль аминокислотных остатков минидомена GGQ 3.3.1. Анализ первичной структуры минидомена GGQ факторов терминации трансляции 1-го класса 3.3.2. Связывание мутантных форм eRF1 с предтерминационным комплексом и их способность вызывать конформационные перестройки 3.3.3. Анализ RF-активности мутантных форм eRF1 3.3.4. Возможный механизм гидролиза пептидил-тРНК в пептидилтрансферазном центре рибосомы эукариот 3.4.Заключение ВЫВОДЫ БЛАГОДАРНОСТИ СПИСОК ЛИТЕРАТУРЫ

СПИСОК СОКРАЩЕНИЙ




АТФ аденозинтрифосфат БСА бычий сывороточный альбумин ДНК дезоксирибонуклеиновая кислота ДТТ дитиотрейтол ед. акт. единица активности мкг микрограмм мкл микролитр мкМ микромолярная концентрация мМ милимолярная концентрация мРНК матричная рибонуклеиновая кислота ОКДДВ остаточная константа диполь-дипольного взаимодействия ПТЦ пептидилтрансферазный центр ПЦР полимеразная цепная реакция РНК рибонуклеиновая кислота РНКаза рибонуклеаза рРНК рибосомная рибонуклеиновая кислота ТЕМЕД N,N,N',N'-тетраэтилендиамид тРНК транспортная рибонуклеиновая кислота ЭДТА этилендиаминтетрауксусная кислота ЯМР ядерный магнитный резонанс ЯЭО ядерный эффект Оверхаузера оптическая плотность при 600 нм OD DTT дезоксинуклеотидтрифосфат dNTP GTP GDP GTPаза изопропилтио--D-галактозид IPTG PAAG фенилметансульфонилфторид PMSF фактор терминации трансляции SDS

ВВЕДЕНИЕ

Механизм терминации трансляции, заключительной стадии биосинтеза полипептидной цепи у эукариот, до настоящего времени остается во многом неизученным. Ключевую роль в узнавании стоп-кодона в А-участке малой субчастицы рибосомы эукариот, передаче сигнала в большую субчастицу, а также последующем гидролизе сложноэфирной связи в пептидил-тРНК играет белковый фактор терминации трансляции первого класса eRF1. Ранее методом рентгеновской кристаллографии было показано, что молекула eRF состоит из трех доменов: N-концевого, или N-домена, среднего, или Мдомена, и С-концевого, или С-домена. N-домен ответственен за узнавание стоп-кодонов матричной РНК. С-домен взаимодействует с фактором терминации второго класса eRF3, за счет чего последний стимулирует активность eRF1. М-домен содержит высококонсервативный трипептидный фрагмент GGQ, необходимый для гидролиза пептидил-тРНК как в эукариотах, так и в прокариотах. Результаты структурных и биохимических исследований указывают на то, что минидомен GGQ располагается в пептидилтрансферазном центре большой субчастицы рибосомы. Абсолютная консервативность GGQ-мотива в факторах терминации первого класса всех живых организмов указывает на его исключительную роль в процессе терминации трансляции.

Полученная ранее структура eRF1 в кристалле имеет относительно низкое разрешение, особенно в подвижных функционально важных участках, таких, как, например, петля, содержащая трипептид GGQ, или GGQ-петля.

Несмотря на интенсивные исследования в области терминации белкового синтеза, проведенные в последнее десятилетие, многие вопросы остаются невыясненными: каким образом происходит передача терминационного сигнала от малой субчастицы рибосомы к большой, как происходит гидролиз пептидил-тРНК и какую роль в нем играет М-домен eRF1? Для понимания механизма реакции терминации трансляции у эукариот необходимы дальнейшие углубленные исследования структуры, динамических свойств и исследования в данном направлении представляются актуальными.





Целями данной работы являлись определение структуры высокого разрешения М-домена eRF1 человека в растворе, изучение его динамических свойств, связывания М-домена eRF1 с рибосомой эукариот и определение трансляции. Для определения структуры М-домена eRF1 нами был выбран метод спектроскопии ядерного магнитного резонанса (ЯМР), который в последние годы широко используется для определения структуры различных белковых молекул в растворе. Методы ЯМР позволяют также определить динамические свойства белка и исследовать его взаимодействие с другими биомолекулами. В задачи работы входило: 1) получение высокоочищенных препаратов М-домена eRF1 человека, меченных стабильными изотопами 13C и N; 2) получение меченого препарата мутантной формы М-домена eRF Gly183Ala, неактивного в функциональных тестах; 3) измерение и последующий анализ гетероядерных 2D и 3D спектров ЯМР для расчета структуры М-домена и определения его динамических свойств; 4) изучение взаимодействия М-домена eRF1 с рибосомами эукариот; 5) выполнение точечных замен аминокислотных остатков в GGQ-петле М-домена eRF методом сайт-направленного мутагенеза; выделение, очистка и исследование функциональной активности полученных мутантных форм eRF1 человека.

В данной работе впервые определена структура высокого разрешения в растворе М-домена eRF1 человека и изучены его динамические свойства. С помощью методов ЯМР нами было исследовано взаимодействие М-домена eRF1 с большой 60S субъединицей рибосомы эукариот, установлена его специфичность и идентифицированы аминокислотные остатки М-домена, образующие возможный интерфейс такого взаимодействия. В работе также было проведено изучение функционального вклада каждого из инвариантных и полуконсервативных аминокислотных остатков в составе минидомена GGQ. Полученные структурные и функциональные данные позволили впервые предложить модель механизма реакции гидролиза пептидил-тРНК в пептидил-трансферазном центре рибосомы, в которой eRF1 служит непосредственным катализатором.

Результаты представленной работы существенно углубляют понимание молекулярного механизма терминации белкового синтеза трансляции у эукариот, что имеет важное значение для детального изучения процесса синтеза белка в эукариотической клетке в целом.

Терминация трансляции, заключительная стадия биосинтеза полипептидной цепи, происходит в тот момент, когда в A-участке рибосомы оказывается один из трех стоп-кодонов транслируемой мРНК – UAA, UAG или UGA. В ответ на присутствие в А-сайте стоп-кодона с рибосомой связываются белковые факторы, получившие название факторов терминации трансляции (RF). Они делятся на два класса. RF первого класса осуществляют узнавание стоп-кодона в А-сайте малой субчастицы рибосомы, передают сигнал в пептидилтрансферазный центр (ПТЦ) большой субчастицы и вызывают гидролиз пептидил-тРНК, в результате чего синтезированный полипептид высвобождается из рибосомы. RF второго активность факторов 1-го класса.

Общая схема терминации трансляции представлена на рисунке 1.1.

После распознавания стоп-кодона RF 1-го класса вызывают гидролиз сложноэфирной связи в пептидил-тРНК, что приводит к высвобождению синтезированного полипептида из рибосомы. У прокариот (рис. 1.1.а) RF 1-го класса диссоциируют из комплекса с рибосомой в результате действия фактора 2-го класса RF3 и GTP. RF3 в комплексе с GDP связывается с рибосомой, затем происходит диссоциация GDP из комплекса и образуется комплекс из рибосомы, RF 1-го класса и RF3. Далее с RF3 связывается GTP, который вызывает конформационные изменения RF3, в результате чего RF 1го класса диссоциируют из рибосомы. Затем происходит гидролиз GTP и диссоциация самого RF3 из рибосомы, после чего с ней связывается фактор рециклинга рибосом RRF. Затем происходит связывание фактора элонгации EF-G в комплексе с GTP и последующий гидролиз GTP, приводящий к диссоциации малой и большой субчастиц рибосомы. После этого с малой Рис. 1.1. Общая схема терминации трансляции у прокариот (а) и эукариот (б) (Petry et al., 2008).

субчастицей связывается фактор инициации IF3, в результате чего происходит высвобождение мРНК и тРНК из Р-сайта. У эукариот (рис. 1.1б) с А сайтом рибосомы связывается фактор терминации 1-го класса eRF1, с которым в свою очередь связывается фактор 2-го класса eRF3. Связывание с eRF1, eRF3 и GTP приводит к полной или частичной транслокации кодона вместе с антикодоновой петлей тРНК из P-частка в Е-участок и стоп-кодона из А-участка в P-участок (Alkalaeva et al., 2006). Далее происходит гидролиз GTP и вновь образованный комплекс eRF3.GDP легко диссоциирует из рибосомы. После этого сложноэфирная связь в пептидил-тРНК гидролизуется под действием eRF1 и высвобождается синтезированный полипептид. После этого, согласно данным недавних исследований, посттерминационный комплекс диссоциирует под действием факторов инициации eIF3, eIF1, eIF1A и eIF3j (Pisarev et al., 2007) 1.2. Факторы терминации трансляции первого класса У прокариот обнаружено два фактора терминации 1-го класса, RF1 и RF2, которые узнают стоп-кодоны UAA/UAG и UAA/UGA, соответственно.

В эукариотах, архебактериях и митохондриях все три стоп-кодона узнаются одним фактором (eRF1, aRF1 и mtRF1, соответственно). Однако, как было обнаружено, в некоторых организмах фактор eRF1 присутствует в виде двух гомологов. У ресничных инфузорий рода Euplotes таких гомологов два ((Inagaki and Doolittle, 2001; Liang et al., 2001), а у растения Arabidopsis thaliana – три (Chapman and Brown, 2004). Неизвестно узнают ли эти гомологи одни и те же или различные стоп кодоны. У человека ген eRF представлен четырьмя копиями – на 5-ой, 6-ой, 7-ой и Х-хромосомах, однако функционально активной является только одна (на 5-ой хромосоме), а остальные представляют собой псевдогены (Guenet et al., 1999).

В нескольких родах инфузорий, таких как Paramecium, Tetrahymena, Stylonychia Oxytrychia, трансляционным аппаратом как глутамин. В качестве стоп-кодона выступает только один UGA (Caron and Meyer, 1985; Preer et al., 1985). Напротив, у инфузорий рода Euplotes стоп-кодоны UAA и UAG являются истинными стоп-кодонами, в то время как UGA-кодон кодирует цистеин (Meyer et al., 1991). У инфузории Blepharisma americanum UGA-кодон, возможно, кодирует триптофан (Lozupone et al., 2001). Декодирование стоп-кодонов в инфузориях было объяснено «гипотезой захвата кодона» (Osawa and Jukes, 1995), которая постулирует превращение стоп-кодонов в смысловые за счет генетических изменений в eRF1, мутационного давления и появлениия новых тРНК.

Прокариотические факторы RF1, RF2 по своей первичной структуре сходны между собой и с митохондриальным фактором mtRF1, однако существенно отличаются от эукариотических и архейных факторов eRF1/aRF1 (Frolova et al., 1994; Frolova et al., 1999; Kisselev et al., 2000; Song et al., 2000). Единственной общей чертой первичных структур всех RF 1-го класса является наличие мотива Gly-Gly-Gln (GGQ) (Frolova et al., 1999).

Абсолютная консервативность мотива GGQ у всех RF 1-го класса свидетельствует о его уникальной роли в процессе терминации трансляции.

Структурные (Laurberg et al., 2008; Petry et al., 2005; Song et al., 2000) и функциональные (Frolova et al., 1999; Mora et al., 2003b; Seit-Nebi et al., 2001;

Shaw and Green, 2007; Song et al., 2000; Zavialov et al., 2002) исследования указывают на его участие в катализе реакции гидролиза сложноэфирной связи в пептидил-тРНК. Механизм катализа до сих пор остается невыясненным.

Накопленные данные структурных и функциональных исследований ряда факторов терминации и элонгации позволили выдвинуть концепцию тРНК-белковой мимикрии, согласно которой некоторые участвующие в биосинтезе белка факторы структурно и функционально схожи с тРНК (Nakamura et al., 2000; Nakamura et al., 1996; Nissen et al., 2000b). Гипотеза мимикрии между тРНК и eRF1 была впервые выдвинута на основании лишь биохимических данных, указывающих на наличие конкуренции eRF1 с Рис. 1.2. Трехмерные структуры факторов терминации трансляции 1-го класса в сравнении с трехмерной структурой тРНК. (а) eRF1 (Song et al., 2000); (б) RF2 (Vestergaard et al., 2001); (в) Met-тРНК (Schmitt et al., 1998).

супрессорной тРНК (Drugeon et al., 1997; Le Goff et al., 1997). Позднее результаты рентгеноструктурного анализа подтвердили это предположение (рис. 1.2). Действительно, в кристалле eRF1 человека имеет структуру, напоминающу по форме букву «Y», сходную по размерам и форме с тРНК (Song et al., 2000).

Молекула eRF1 состоит из трех доменов: N-концевого (N-домена), среднего (М-домена) и С-концевого (С-домена) (рис. 1.2а).

Соответствующий антикодоновой ветви тРНК N-домен содержит сайт распознавания стоп-кодона. На это указывают: а) данные мутационного анализа in vivo на дрожжевом eRF1 (Bertram et al., 2000; Fan-Minogue et al., 2008) и биохимические данные полученные in vitro на eRF1 человека (Frolova et al., 2002; Kolosov et al., 2005; Seit-Nebi et al., 2002), в которых сайтнаправленный мутагенез ряда аминокислотных остатков внутри N-домена приводил к существенным изменениям в декодировании стоп кодона; б) данных о специфичности к стоп-кодонам химерных белков (Ito et al., 2002;

Lekomtsev et al., 2007; Salas-Marco et al., 2006); в) данных по химическим сшивкам между первым U стоп-кодона и N-доменом eRF1 человека (Chavatte et al., 2002). Однако, точная последовательность и структура декодирующего сайта все еще неизвестны.

На противоположном конце молекулы находится М-домен, который Пространственное расположение М-домена, а также нахождение в его составе инвариантного мотива GGQ, указывают на его роль в связывании с ПТЦ и индукции гидролиза пептидил-тРНК.

Функции С-домена до сих пор до конца не выяснены. Известно, что его удаление из eRF1 не вызывает потерю RF-активности фактора in vitro (Frolova et al., 2000). Было установлено, что С-домен взаимодействует с фактором терминации второго класса eRF3 (Eurwilaichitr et al., 1999;

Merkulova et al., 1999).

взаимодействие eRF1 с другими белками. Обнаружено, что такие белки как Upf1p, Upf2p и Upf3p (Wang et al., 2001), Mtt1p (Czaplinski et al., 2000) и Itt1p (Urakov et al., 2001) способны связываться с дрожжевым eRF1, однако сайты связывания не установлены.

Сравнение кристаллических структур eRF1 (Song et al., 2000) и RF2 E.

coli (Vestergaard et al., 2001) показало, что не только по первичной, но и по пространственной структуре прокариотический и эукариотический факторы терминации трансляции 1-го класса сильно различаются. Молекула RF образована четырьмя доменами, расположенными по отношению друг к другу намного более компактно за счет большего количества междоменных нековалентных контактов (рис. 1.2б). При этом домены 2, 3 и 4 образуют практически глобулярную структуру, в основании которой находится относительно вытянутый домен 1. Несмотря на то, что общие размеры молекулы RF2 близки к размерам тРНК, в целом RF2 выглядит более объемным, что может говорить о большем числе возможных участков связывания с рибосомой. Мотив GGQ в данном случае, также как и в молекуле eRF1, образует петлю экспонированную на поверхности молекулы.

Расстояние между «трипептидным антикодоном» SPF, ответственным за декодирование стоп-кодона в А-сайте малой субчастицы рибосомы (см.

ниже), и мотивом GGQ в полученной кристаллической структуре RF составляет лишь 23, в то время как в молекуле тРНК расстояние между 3’ССА концом и антикодоновой петлей составляет 75. Таким образом, исходя из расстояния в кристалле мотив SPF и мотив GGQ не могут располагаться в декодирующем центре и в ПТЦ, соответственно, в одно и то же время.

Однако, как показало криоэлектронное микроскопическое исследование терминационного комплекса, при связывании с рибосомой происходит изменение конформации RF2 (рис. 1.3). Связавшись с рибосомой, фактор переходит в «открытую» конформацию, в результате чего мотив SPF узнает стоп-кодон в А-сайте малой субчастицы рибосомы, а GGQ-мотив взаимодействует с ПТЦ (Klaholz et al., 2003; Rawat et al., 2003). Такую смену конформации в ответ на связывание со стоп-кодоном претерпевает и фактор RF1, который в кристалле в свободной форме также находится в «закрытой»

конформации (Rawat et al., 2006; Shin et al., 2004). Как показали недавние исследования с помощью метода малоуглового рассеивания рентгеновских лучей, в растворе RF1 в свободной форме находится в «открытой»

конформации (Vestergaard et al., 2005).

Изменение конформации при связывании с рибосомой предполагается и для eRF1, в котором расстояние между узнающим первый U стоп-кодона мотивом NIKS (см. ниже) и GGQ составляет около 100 (Kisselev, 2002; Ma and Nussinov, 2004; Song et al., 2000).

Ma and Nussinov (2004) предположили, что в основе механизма изменения конформации RF2 лежит протонирование остатков гистидина в белке. Исследователи предполагают, что такой механизм может быть общим для прокариотических и эукариотических RF.

Рис. 1.3. Трехмерная структура прокариотического фактора терминации RF2.

Показано взаимное расположение SPF и GGQ мотивов в «закрытой» конформации RF2 в кристалле (Vestergaard et al., 2001) (А) и в «открытой» конформации при связывании с рибосомой (Klaholz et al., 2003) (Б).

1.3. Факторы терминации трансляции второго класса Факторы терминации трансляции второго класса – RF3 у прокариот и eRF3 у эукариот – представляют собой рибосомозависимые GTP-азы. Было показано, что для реакции терминации трансляции in vitro их участие не является необходимым (Frolova et al., 1994; Grentzmann et al., 1994; Mikuni et al., 1994; Zhouravleva et al., 1995). (Freistroffer et al., 1997)) установили, что RF3 E. coli не влияет на скорость связывания RF1 или RF2 с рибосомами, содержащими пептидил-тРНК в Р-сайте и стоп-кодон в А-сайте. Кроме того, было обнаружено, что RF3 так же не влияет на константу скорости гидролиза сложноэфирной связи в пептидил-тРНК. Однако под действием RF значительно повышалась скорость диссоциации факторов первого класса из терминационного комплекса, причем GTP-зависимым образом. Из этих экспериментов можно заключить, что функцией RF3 в терминационной реакции является высвобождение RF1 и RF2 из рибосомы в посттерминационном состоянии. Ранее предполагалось, что свободная форма RF присутствует в цитоплазме в комплексе с GTP. Это предположение основывалось на том, что соотношение GTP/GDP в клетке очень высоко, а также на экспериментальных данных, свидетельствующих о том, что связывание RF3 с GDP всего в пять раз сильнее его связывания с GTP (Mortensen et al., 1995). Однако позднее было выяснено, что RF3 связвается с GDP по крайней мере на три порядка сильнее, чем с GTP (Zavialov et al., 2001). Эти данные говорят о том, что цитоплазматическая форма RF3, скорее всего, связана с GDP. Таким образом, RF3 должен в GDP-связанной форме подойти к рибосоме, после чего, если в рибосоме присутствует RF 1-го класса, GDP быстро диссоциирует из комплекса. Эта реакция происходит как в присутствии пептидил-тРНК, так и в присутствии деацилированной тРНК в Р-сайте (Zavialov et al., 2002) и приводит к образованию стабильного комплекса, состоящего из RF1 или RF2 и свободной формы (не связанной с гуанидином) RF3. Далее с RF3 связывается GTP, что приводит к изменению его конформации. Изменение конформации RF3 способствует диссоциации RF1/RF2 из рибосомного комплекса. Механизм, по которому RF3 вызывает диссоциацию RF 1-го класса из терминационного комплекса до конца не изучен. Результаты недавно проведенной криоэлектронной микроскопии комплекса RF3 с рибосомой позволяют предполагать, что RF3 вызывает конформационные перестройки в рибосоме, что, в свою очередь, приводит к диссоциации RF1/RF2 (Gao et al., 2007). В результате, образуется стабильный комплекс рибосомы, деацилированной тРНК в P-сайте и RF3 в связанной с GTP форме. Дальнейший гидролиз GTP необходим для диссоциации RF3 из рибосомы, в результате чего фактор способен принимать участие в новом цикле терминации трансляции (Zavialov et al., 2001; Zavialov et al., 2002).

Наименее изученной стадией в терминации трансляции прокариот является диссоциация посттерминационного комплекса и подготовка компонентов аппарата трансляции для следующего цикла. Считается, что главную роль в этом процессе выполняет фактор рециклинга рибосом RRF Посттерминационный комплекс содержит мРНК, деацилированную тРНК в P-участке и RRF в А-участке. Согласно одной из гипотез, EF-G за счет

GTP RRF

деацилированную тРНК из Р-участка в Е-участок рибосомы. Затем компоненты. Согласно второй гипотезе, RRF и EF-G способствуют диссоциации рибосом на субъединицы в GTP-зависимой реакции, а фактор инициации IF3 обеспечивает выход деацилированной тРНК из Р-участка 30S субъединицы (Karimi et al., 1999; Peske et al., 2005).

Механизм работы эукариотического фактора терминации 2-го класса eRF3 изучен намного меньше, чем RF3. Молекулу eRF3 можно поделить на части: С-концевую и N-концевую. С-концевой участок eRF3 является высококонсервативным и абсолютно необходим для жизнеспособности клеток (Ter-Avanesyan et al., 1993). Эту часть молекулы eRF3 можно соответствующие домены в RF3 и в факторах элонгации EF-G, EF-Tu и EF1А, и второй С-домен, необходимый для взаимодействия с eRF1 (см.

обзоры (Kisselev et al., 2003; Kisselev and Buckingham, 2000).

В отличие от C-концевого участка, N-участок и отличается по длине и аминокислотной последовательности у разных организмов (Kushnirov et al., 1990). N-концевой участок не является жизненно необходимым и не участвует в терминации трансляции, но ответственен за взаимодействие с poly(A)-связывающим белком (PABP), которое является связующим звеном между терминацией и инициацией биосинтеза белка (Hoshino et al., 1999). В дрожжах S. cerevisiae N-домен eRF3 ответствен за образование прионной формы eRF3 [PSI+]. В клетках с генотипом [PSI+] фактор eRF3 образует эффективности терминации трансляции и повышению уровня сквозного прочтения на стоп-кодонах (Paushkin et al., 1996). В настоящее время неизвестно, возможно ли образование прионной формы eRF3 у высших эукариот.

У дрожжей было показано, что eRF3, кроме взаимодействия с eRF1, также взаимодействует с белками Upf1p, Upf2p и Upf3p, входящими в состав РНК-белкового комплекса, участвующего в деградации мРНК, содержащих преждевременный стоп-кодон (NMD). Эти взаимодействия, по-видимому, также оказывают влияние на эффективность терминации трансляции (Wang et al., 2001).

Kong et al. (2004) определили кристаллическую структуру С-концевой части eRF3 S.pombe, которая, как оказалось, в общих чертах напоминает структуру EF-Tu. Однако в отличие от EF-Tu, связывание eRF3 с GTP/GDP не приводит к большим конформационным изменениям eRF3. Ионы Mg2+ не влияют на связывание GTP с дрожжевым eRF3, а при высокой концентрации увеличивают высвобождение GTP из комплекса eRF3·GTP (Kong et al., 2004).

Исследователи высказали предположение, что обладает иным механизмом нуклеотидного обмена по сравнению с другими GTPазами.

Недавно был проведен ряд исследований, связанных со взаимодействием eRF3 с GTP (Hauryliuk et al., 2006; Kononenko et al., 2007; Mitkevich et al., 2006; Pisareva et al., 2006), результаты которых позволили сделать ряд важных выводов. Свободный eRF3 имеет более высокое сродство к GDP, чем к GTP, и вероятно, в клетке eRF3 находится в связанной с GDP форме (eRF3·GDP), как и RF3 у прокариот. Однако, eRF1 оказывает сильный эффект на связывание GTP c eRF3 при образовании комплекса eRF1·eRF3. Такой комплекс уже имеет большее сродство к GTP, чем к GDP. Таким образом, скорее всего факторы терминации eRF1 и eRF3 связываются с рибосомой в форме комплекса eRF1·eRF3·GTP, аналогично связыванию комплекса EF1A·GTP·аминоацил-тРНК с рибосомой.

Вопрос каким образом eRF3 способствует терминации трансляции до сих пор остается открытым. Согласно схеме терминации трансляции, предложенной Alkalaeva et al. (2006), eRF3 непосредственно участвует в процессе гидролиза пептидил-тРНК в рибосоме вместе с eRF1, способствуя правильному позиционированию мотива GGQ в ПТЦ. По мнению авторов, при связывании с предтерминационным комплексом eRF1, eRF3 и GTP, мотив в ПТЦ располагается неправильно, что препятствует расщеплению пептидил-тРНК. В результате гидролиза вновь образованный комплекс eRF3.GDP легко диссоциирует из рибосомы, способствуя правильному расположению GGQ мотива в ПТЦ и расщеплению пептидил-тРНК последующим высвобождением синтезированного полипептида. Предложенная схема согласуется с генетическими данными, полученными in vivo (Salas-Marco and Bedwell, 2004).

Исходя из выше представленных данных, можно сделать вывод, что прокариотический RF3 и эукариотический eRF3 выполняют разные роли в процессе терминации трасляции. RF3 способствует высвобождению RF1/RF из рибосомы, а eRF3 способствует быстрому и эффективному расщеплению пептидил-тРНК. Основное различие заключается в том, что расщепление пептидил-тРНК у прокариот предшествует и необходимо для гидролиза GTP, тогда как у эукариот гидролиз GTP необходим для расщепления пептидилтРНК. Другой механизм работы eRF3 у эукариот возможно, связан с необходимостью более точного узнавания всех трех стоп-кодонов с помощью одного eRF1, в то время как у прокариот высокая специфичность узнавания стоп-кодонов достигается за счет разделения функции узнавания между двумя факторами RF1 и RF2.

1.4. Декодирование стоп-кодона факторами терминации Распознавание стоп-кодона, в принципе, может осуществляться тремя путями: а) за счет самой рибосомы; б) за счет RF; в) в результате комбинированного действия рибосомы и RF. Было предположено, что рРНК может непосредственно взаимодействовать со стоп-кодоном мРНК (Arkov and Murgola, 1999).

экспериментами. Во-первых, мутации рРНК существенно влияют на терминацию трансляции (Green and Noller, 1997; Velichutina et al., 2001). Вовторых, стоп-кодоны находятся в тесном контакте с рРНК в рибосоме (Chavatte et al., 2001; Chavatte et al., 2002; Poole and Tate, 2000). В-третьих, два сегмента прокариотической 23S рРНК (петли 69 и 89) могут принимать антикодоновыми, комплиментарными стоп-кодонам (Ivanov et al., 2001). Тем не менее, роль рРНК в декодировании стоп-кодонов до конца не выяснена.

Существует ряд свидетельств о прямом взаимодействии факторов терминации первого класса со стоп кодонами (Moffat and Tate, 1994;

Nakamura et al., 1996). Показано, что факторы терминации первого класса образуют специфические химические сшивки с нуклеотидами стоп-кодонов мРНК (Bulygin et al., 2002; Chavatte et al., 2001; Chavatte et al., 2002; Poole and Tate, 2000). Установлено, что мутации в прокариотических (Ito et al., 2000;

Nakamura and Ito, 1998; Uno et al., 2002) и дрожжевых (Bertram, 2000; FanMinogue et al., 2008) RF 1-го класса, а также eRF1 человека (Frolova et al., 2002; Kolosov et al., 2005; Seit-Nebi et al., 2002) влияют на распознавание стоп-кодона.

Функциональные исследования, проведенные Ito et al. (2000), показали, что в прокариотических факторах RF1 и RF2 основную роль в определении специфичности узнавания стоп-кодона играют трипептидные мотивы ProAla/Val-Thr (P(A/V)T) и Ser-Pro-Phe (SPF), соответственно. Эти мотивы были исследователи, осуществляют прямое распознавание второго и третьего нуклеотида в стоп-кодоне. Структурные исследования также подтверждают гипотезу «белковых антикодонов»: в кристалле комплексов RF1 и RF2 в рибосоме петли факторов, содержащие мотивы P(A/V)T и SPF, сближены со стоп-кодоном в А-сайте (Laurberg et al., 2008; Petry et al., 2005). Недавно Laurberg et al. (2008) показали что мотив P(A/V)T взаимодействует с первым и вторым основанием стоп-кодона, а не вторым и третьим, тем не менее, данные взаимодействия осуществляются фактором напрямую, а роль 16S рРНК, по-видимому, заключается в правильном позиционировании RF1 в Асайте.

Относительно механизма декодирования стоп-кодона у эукариот фактором eRF1 предложено несколько гипотез, выдвинутых на основании данных по мутагенезу eRF1 (Bertram et al., 2000; Kolosov et al., 2005; SeitNebi et al., 2002) или анализе первичных структур eRF1 из различных организмов (Inagaki et al., 2002; Liang et al., 2005; Muramatsu et al., 2001;

Nakamura et al., 2000).

аминокислотных остатков N-домена, предположительно участвующих в декодировании стоп-кодона (табл. 1.1). Гипотеза «белкового антикодона»

(Nakamura et al., 2000) заключается в том, что eRF1 узнает стоп-кодоны с помощью линейной последовательности аминокислотных остатков аналогично прокариотическим факторам RF1 и RF2. Было высказано предположение, что роль «белкового антикодона» могут играть Thr-Ala-Ser (положения 58-60; здесь и далее нумерация соответствует eRF1 человека).

Таблица 1.1. Аминокислотные остатки, участвующие в декодировании стопкодонов согласно различным гипотезам. Нумерация соответствует eRF1 человека.

Muramatsu et al. (2001) предположили, что таким антикодоном могут быть аминокислотные остатки Gly57, Thr58, Asn60 и Ile61. По мнению авторов, Gly57 и Thr58 ответственны за узнавание второго, а Asn60 и Ile61 – третьего нуклеотида стоп-кодона. Согласно кристаллической структуре eRF положения 57/58 и 60/61 соответствуют положению антикодона в тРНК и расстояние между аминокислотными остатками 57/58 и 60/61 близко по значению к расстоянию между 2-ым и 3-им основаниями стоп-кодона.

Авторы предполагают, что в за узнавание 1-го U в стоп-кодоне ответствен остаток глутаминовой кислоты в положении 55.

Bertram et al. (2000), основываясь на биохимических исследованиях in vivo и результатах молекулярного моделирования, предположили, что стопкодон распознается не линейной последовательностью, а группой аминокислотных остатков eRF1, удаленных друг от друга в первичной структуре и образующих «узнающую полость» в пространстве. Для каждого из нуклеотидных оснований стоп-кодона предложен набор аминокислотных остатков, образующий "узнающую полость". Для первого основания стопкодона это аминокислотные остатки Met51 и Ser123, второго – Leu126, Asp128 и His132, третьего – Glu55, Val71, Tyr125 и Cys127. Inagaki et al.

(2002) считают, что "узнающие" стоп-кодон аминокислотные остатки, предложенные Bertram et al. (2000), идентифицированы верно, однако антикодон должен располагаться в противоположной ориентации при взаимодействии с eRF1. В результате чего, 1-ый нуклеотид стоп-кодона находится в "узнающей полости", образованной Glu55, Val71, Tyr125 и Cys127, а 3-ий – Met51 и Ser123.

специфичностью узнавания стоп-кодонов и биоинформатического анализа предположительно участвующих в узнавании стоп-кодонов. Из них пять являются абсолютно консервативными в семействе eRF1 (Gly31, Thr32, Ile62, Lys63 и Cys127), а остальные три (положения 57, 70 и 126) консервативны в группах eRF1 с одинаковой специфичностью узнавания (Ser57, Ser70 и Phe126 для UGA-специфичных eRF1; Gly57, Ala70 и Ile126 для UARспецифичных eRF1; Gly57, Ser70 и Leu126 для омнипотентных eRF1).

консервативных мотива в N-домене, имеющих критическое значение в процессе распознавания стоп-кодона: NIKS (положения 61-64) и YxCxxxF (положения 125-131) (Frolova et al., 2002; Kolosov et al., 2005; Seit-Nebi et al., 2002). Введение мутаций в эти мотивы приводило к значительным изменениям в специфичности узнавания стоп-кодонов. Инвариантный дипептид Ile-Lys в составе мотива NIKS, как предполагают, участвует в узнавании первого нуклеотида U стоп-кодона. Данное предположение основано на том, что Lys63 образует химические сшивки с 4-тиоуридином, находящимся в 1-ом положении стоп-кодона (Chavatte et al., 2002). За узнавание 2-го и 3-го нуклеотида, вероятно, ответственен мотив YxCxxxF (Kolosov et al., 2005; Seit-Nebi et al., 2002). Основную роль в узнавании А во 2-ом положении стоп-кодона играют Cys127 и Phe131, а Tyr125 осуществляет узнавание нуклеотида в 3-м положении. Предполагается, что Tyr125 важен для поддержания правильной конформации декодирующего сайта eRF1 и, возможно, образует водородную связь с Glu55 (Kolosov et al., 2005).

В пространственной структуре eRF1 мотивы NIKS и YxCxxxF расположены в разных петлях (рис. 1.4) и расстояние между ними составляет 15 (Song et al., 2000). На основании данных по химическим сшивкам, а также данных по моделированию предположено, что eRF1 может менять конформацию при узнавании стоп-кодона, в результате два мотива становятся сближенными, что способствует эффективному узнаванию стопкодона в мРНК (Chavatte et al., 2003).

Рис. 1.4. Трехмерная структура N-домена eRF1 человека. Указана локализация YxCxxxF и NIKS мотивов. E55 – остаток глутаминовой кислоты в 55 положении, Y125 – остаток тирозина в 125 положении (Kolosov et al., 2005) Из представленных гипотез видно, что данные о механизме узнавания стоп-кодонов и о роли в нем отдельных аминокислотных остатков eRF противоречивы, поэтому необходимы дальнейшие исследования в этой области. Тем не менее, очевидно, что наибольшее экспериментальное подтверждение получили гипотезы, рассматривающие узнающий сайт eRF как комплекс нескольких аминокислотных остатков в пространстве. Остается неизвестным, осуществляет ли eRF1 декодирование стоп-кодона напрямую, либо этот процесс опосредуется рРНК. Так как по своей пространственной структуре eRF1 схож с тРНК (Song et al., 2000), то вполне обосновано предположение о формировании тройного комплекса, состоящего из стоп кодона, рРНК малой субчастицы и фактора терминации первого класса.

Таким образом, возможно, основная специфичность распознавания стопкодона осуществляется за счет фактора, а сила взаимодействия и стереохимия, усиливающая его специфичность, находится под влиянием рРНК.

1.5. Гидролиз пептидил-тРНК в пептидилтрансферазном центре 1.5.1. Молекулярная анатомия пептидил-трансферазного центра Расположенный на большой субчастице рибосомы пептидил-трансферазный центр (ПТЦ) играет ключевую роль в процессе белкового синтеза (Polacek and Mankin, 2005). ПТЦ необходим как для формирования пептидной связи между остатками аминокислот в ходе синтеза полипептидной цепи (реакция транспептидации), так и для высвобождения синтезированной полипептидной цепи при терминации трансляции за счет гидролиза пептидил-тРНК. Он представляет собой сложный динамический комплекс с молекулярной массой приблизительно 1,8 МДа. ПТЦ расположен в районе «шеи» (в борозде под центральным выступом) большой субчастицы рибосомы и представляет собой плотно упакованный участок, состоящий из нуклеотидов центральной петли домена V 23S рРНК (Ban et al., 2000; Harms et al., 2001) (рис. 1.5). Это наиболее высококонсервативный участок во всей рибосоме. Рибосомальные белки находятся не ближе, чем на расстоянии от него (Nissen et al., 2000a). Ближе всего к ПТЦ подходят длинные «хвосты»

рибосомальных белков L2, L3, L4 и L10e, которые тянутся от расположенных на поверхности 50S субчастицы глобулярных доменов в ядро рибосомы (Nissen et al., 2000a). Эти «хвосты», возможно, важны для поддержания структуры ПТЦ. Таким образом, в ПТЦ не обнаружено наличние каких-либо рибосомальных белков, которые могли бы принимать участие в катализе реакций транспептидации и гидролиза пептидил-тРНК. При исследовании кристаллической структуры 50S субчастиц рибосом H. marismortui, а также их комплексов с субстратными аналогами, в ПТЦ не удалось выявить наличие каких-либо каталитических ионов металлов (Steitz, 2005).

Единственным ионом металла, обнаруженным во внутренней полости ПТЦ, был ион калия, который, вероятно, участвует в координации нуклеотидов А2451, G2447 и G2061 (здесь и далее нумерация по 23S рРНК Е. coli) (Nissen et al., 2000a). По-видимому, функциональная роль ПТЦ обеспечивается исключительно рРНК.

Рис. 1.5. Кристаллическая структура большой субчастицы рибосомы H.

marismortui. Желтым цветом выделены 23S и 5S рРНК, зеленым - рибосомальные белки. ПТЦ выделен красным цветом. Справа показана вторичная структура центральной петли домена V 23S рРНК E. coli (Polacek and Mankin, 2005).

Позиционирование ССА-концов находящихся в А- и Р-сайте тРНК происходит за счет взаимодействия с 23S рРНК (Yusupov et al., 2001). В Рсайте С74 и С75 тРНК комплементарно взаимодействуют с G2252 и G2251 Pпетли 23S рРНК (Samaha et al., 1995). ССА-конец тРНК, расположенной в Асайте, закрепляется в ПТЦ за счет комплементарной пары С75 тРНК и G 23S рРНК (Kim and Green, 1999). На поверхность каталитического центра выступают абсолютно консервативные нуклеотиды 23S рРНК А2602, U2585, U2506, A2451 и С2063 (Nissen et al., 2000a).

1.5.2. Роль рРНК в реакции гидролиза пептидил-тРНК Как уже было отмечено, в ПТЦ происходят две ключевые реакции процесса трансляции: реакция транспептидации, в том случае, когда в Асайте находится аминоацил-тРНК, и реакция гидролиза пептидил-тРНК, которая запускается присутствием в А-сайте RF 1-го класса. Реакция транспептидации заключается в аминолизе сложноэфирной связи между синтезирующимся пептидом и 3’-гидроксилом 3’-концевого остатка рибозы тРНК, находящейся в Р-сайте. Аминолиз осуществляется посредством нуклеофильной атаки -аминогруппы находящейся в А-сайте аминоацилтРНК. На первом этапе происходит депротонирование -NH3+-группы, что приводит к образованию нуклеофильной группы NH2. Акцептором протона, наиболее вероятно, служит молекула воды. Затем следует нуклеофильная атака -аминогруппой аминоацил-тРНК карбонильной группы пептидилтРНК. Это вызывает формирование промежуточного тетраэдрического интермедиата. После этого происходит переход протона на атом кислорода, в результате чего комплекс распадается, и образуются продукты реакции – деацилированная тРНК в Р-сайте и элонгированная пептидил-тРНК в А-сайте (рис. 1.6А). Гидролиз пептидил-тРНК происходит, наиболее вероятно, посредством нуклеофильной атаки сложноэфирной связи молекулой воды (Tate and Brown, 1992) (рис. 1.6Б). Согласно (Amort et al., 2007) такая атака карбонильного атома углерода сложноэфирной связи пептидил-тРНК приводит к формированию тетраэдрического интермедиата. Затем происходит перенос протона на 2’(3’)-гидроксил 3’-концевого аденозина пептидил-тРНК и сложноэфирная связь между остатками пептидила и тРНК разрывается. В отличие от реакции транспептидации, где связь атакуется аминогруппой аминоацил-тРНК, которая является сильным нуклеофилом, реакция гидролиза пептидил-тРНК осуществляется слабым нуклеофилом – атомом кислорода молекулы воды. Спонтанный гидролиз пептидил-тРНК происходит очень медленно: в прокариотической рибосоме один раз в часов (Zavialov et al., 2002). При наличии RF 1-го класса в А-сайте скорость Рис. 1.6. Общая схема реакции транспептидации (А) и реакции гидролиза пептидил-тРНК (Б) в пептидилтрансферазном центре.

реакции гидролиза значительно возрастает. Эксперименты in vitro показали, что в прокариотическом терминационном комплексе константа скорости реакции высвобождения полипептида составляет 0,5-1,5 в секунду (Zavialov et al., 2002). Очевидно, что в процессе терминации трансляции в ПТЦ какимто образом должна происходить координация и активация молекулы воды.

Что обеспечивает такую координацию и активацию, какова роль ПТЦ и RF 1го класса в механизме реакции гидролиза пептидил-тРНК, до сих пор достоверно неизвестно.

Во второй половине 1960ых и 1970е годы механизм формирования пептидной связи изучался в модельных системах, состоящих из рибосомы (или ее большой субчастицы), fMet-тРНК, ионов Mg2+ и K+/NH4+, пуромицина или ацетона/этанола/метанола (Caskey et al., 1971). Эти и другие эксперименты привели к появлению концепции о том, что реакция транспептидации в рибосоме осуществляется при непосредственном участии ПТЦ. Появление кристаллической структуры 50S субъединицы рибосомы позволило довольно подробно охарактеризовать структурные и функциональные особенности ПТЦ (Hansen et al., 2002a; Hansen et al., 2002b;

Nissen et al., 2000a; Polacek and Mankin, 2005; Schmeing et al., 2002). Было установлено, что ПТЦ играет роль в формировании пептидной связи не за счет кислотно-основного катализа реакции, а, скорее, посредством уменьшения энтропии транспептидазной реакции, координируя в пространстве все ее компоненты (Bieling et al., 2006; Rodnina et al., 2007;

Schmeing et al., 2005).

Так как реакция терминации трансляции также происходит в ПТЦ, наиболее распространена гипотеза о том, что непосредственным катализатором реакции гидролиза пептидил-тРНК служит 23S рРНК ПТЦ.

Главным аргументом в пользу этой гипотезы являются результаты экспериментов, которые показали наличие гидролиза fMet-тРНК как в прокариотических, так и в эукариотических рибосомах, в отсутствии RF 1-го класса и стоп-кодона мРНК в А-сайте, но в присутствии деацилированной тРНК и 30% ацетона (Caskey et al., 1971). Однако описанная модельная система далека от природной, во-первых, из-за присутствия 30% ацетона. Вовторых, концентрация ионов Mg2+ в ней была слишком высока. И, в-третьих, в описанной системе в А-сайте, который в норме занят либо аминоацилтРНК, либо пептидил-тРНК, находилась деацилированная тРНК, а в Р-сайте находился fMet-тРНК, в то время как при терминации его постоянно занимает пептидил-тРНК с длинной полипептидной цепью. Более того, так как в описанной модельной системе терминация трансляции проходила без физиологической. Следует отметить, что в отсутствие 30% ацетона или деацилированной тРНК в А-сайте рибосома сама по себе была неспособна осуществлять гидролиз сложноэфирной связи в fMet-тРНК (Caskey et al., 1971). В случае, если в А-сайте находится стоп-кодон, деацилированная тРНК не вызывает реакцию гидролиза (Zavialov et al., 2002).

Тем не менее, очевидно, что структура ПТЦ очень важна для терминационного процесса. Было предположено, что некоторые из высококонсервативных нуклеотидов ПТЦ (А2602, U2585, U2506, A2451 и С2063, нумерация соответствует 23S рРНК E. coli) вовлечены в реакцию терминации (Polacek et al., 2003; Youngman et al., 2004).

Замены нуклеотидов С2063, А2451, U2585 и U2506 оказывают лишь умеренное влияние на гидролиз пептидил-тРНК (Polacek et al., 2003;

Youngman et al., 2004). Наиболее сильное влияние на процесс терминации оказывали мутации нуклеотида А2602, которые приводили к потере способности терминационного комплекса гидролизовать пептидил-тРНК, не оказывая при этом значительных эффектов на пептидилтрансферазную реакцию (Brunelle et al., 2006; Polacek et al., 2003; Youngman et al., 2004).

Такой эффект мутации А2602 наблюдался как в присутствие RF 1-го класса в А-сайте, так и в описанной выше модельной системе без участия факторов терминации, но в присутствии деацилированной тРНК в А-сайте и 30% ацетона (Caskey et al., 1971; Polacek et al., 2003). Мутации U2585 в рибосомах E. coli также приводили к снижению скорости высвобождения пептида, однако в меньшей степени, чем мутации А2602 (приблизительно в 40 раз и в 350 раз, соответственно) (Youngman et al., 2004). На основе анализа данных мутационного исследования была выдвинута гипотеза о том, что RF 1-го класса индуцируют гидролиз пептидил-тРНК посредством реориентирования А2602 в ПТЦ, который в результате этого становится способен активировать молекулу воды (Polacek and Mankin, 2005). В позиционировании А2602 также принимает участие U2585 – второй наиболее подвижный нуклеотид в ПТЦ (Schmeing et al., 2002). Согласно этой модели RF 1-го класса играют регулирующую роль, а непосредственно катализ гидролиза пептидил-тРНК осуществляется самой рибосомой.

Позднее Trobro and Aqvist (2007) на основе данных молекулярного моделирования предложили другую гипотезу о роли нуклеотида А2602 в процессе терминации трансляции. В описанной ими модели А выполняет функцию стабилизации структуры GGQ мотива RF1 за счет формирования водородных связей между адениновым остатком А2602 и консервативных остатков GGQ-мотива (Trobro and Aqvist, 2007).

Координация же молекулы воды осуществляется атомами боковой цепи Gln230.

Однако результаты недавних исследований, проведенных Amort et al.

(2007), опровергают обе этих гипотезы. Тщательное исследование рибосом, содержащих мутации в 23S рРНК, показало, что отсутствие азотистого основания или замена нуклеотида на его дезоксирибозный аналог в консервативных положениях А2602, U2585, U2506, A2451 и С2063 не препятствует гидролизу пептидил-тРНК (Amort et al., 2007). По-видимому, описанное ранее влияние замены нуклеотидов в положениях А2602 и U на реакцию гидролиза пептидил-тРНК объясняется конформационными нарушениями в ПТЦ, так как при последующей замене мутированных нуклеотидов на их аналоги без азотистых оснований терминационная активность восстанавливается. Тем не менее, для сохранения как RFзависимого, так и RF-независимого (под действием деацилированной тРНК) гидролиза пептидил-тРНК абсолютно необходима целостность рибозного кольца в положении 2602 (Amort et al., 2007). Единственным атомом в остатке рибозы 2602, способным выполнять функцию координации и активации молекулы воды, является несущий неспаренный электрон атом О4’. Однако, это маловероятно, принимая во внимание слишком большое расстояние между ним и аминогруппой пептидил-тРНК. Amort et al. (2007) предположили, что А2602 играет роль «молекулярного переключателя», который регулирует специфичность ПТЦ либо к формированию пептидной связи, либо к реакции гидролиза пептидил-тРНК в зависимости от того, находится ли в А-сайте аминоацил-тРНК или RF 1-го класса. В ответ на связывание RF 1-го класса в А-сайте происходит смещение А2602, которое позволяет молекуле воды попасть в активный сайт.

Следует также отметить, что для RF-зависимого пептидил-тРНК гидролиза важны комплементарные взаимодействия между G2252 23S рРНК и С74 тРНК в Р-сайте, которые, однако, не влияют на реакцию транспептидации (Feinberg and Joseph, 2006). Возможно, образование комплементарной пары С74-G2252 обеспечивает правильную ориентацию пептидил-тРНК относительно фактора терминации 1-го класса.

Таким образом, вопрос какая функциональная группа ответственна за координацию молекулы воды и катализ гидролиза пептидил-тРНК остается открытым. Помимо ПТЦ, эту роль могут выполнять либо сами RF 1-го класса, либо 2’-гидроксил нуклеотида А76 пептидил-тРНК. Установлено, что А76 пептидил-тРНК играет важную роль в реакции транспептидации (Weinger et al., 2004). Результаты исследований позволили предложить модель механизма формирования пептидной связи в рибосоме, в которой 2’гидроксил А76 служит передатчиком протона, принимая протон аминогруппы и передавая его на атом О3’ пептидил-тРНК (Changalov et al., 2005). Возможно ли, что реакция гидролиза пептидил-тРНК протекает по сходному механизму, остается неизвестным.

1.5.2. Роль факторов терминации трансляции первого класса в Полученные кристаллические структуры комплексов прокариотической рибосомы с RF1 и RF2 (Petry et al., 2005), а также результаты криоэлектронной микроскопии (Klaholz et al., 2003; Rawat et al., 2003) показали, что факторы терминации трансляции 1-го класса взаимодействуют как с декодирующим сайтом, так и с ПТЦ. С ПТЦ взаимодействует петля молекулы RF 1-го класса, содержащая универсальный мотив Gly-Gly-Gln (GGQ), которая сближена с нуклеотидами А2602, U2506, А2451 и C2063 23s рРНК (нумерация по E. coli) (Petry et al., 2005). Трипептидный мотив GGQ является абсолютно консервативным для всех RF 1-го класса, несмотря на их происхождение и специфичность к тому или иному стоп-кодону (рис. 1.7) (Frolova et al., 1999). Это единственный участок первичной структуры, общий для всех факторов терминации трансляции, как для RF1/RF2 прокариот и митохондрий, так и для eRF1 эукариот и aRF1 архебактерий, что свидетельствует о его уникальной роли в процессе терминации трансляции.

В eRF1 человека мотив GGQ находится в петле, входящей в состав Мдомена, который структурно имитирует акцепторный конец молекулы тРНК (Ito et al., 1996; Song et al., 2000). Было предположено, что мотив GGQ в функциональном отношении можно приравнять к универсальному мотиву 3’ССА тРНК (Frolova et al., 1999). Таким образом, вероятнее всего, именно минидомен GGQ является участком RF 1-го класса, принимающим участие в гидролизе пептидил-тРНК. Данные мутационного анализа подтверждают это предположение. Мутации любого из двух глицинов в мотиве GGQ вызывают потерю RF-активности in vitro в эукариотах (Frolova et al., 1999; Seit-Nebi et al., 2001) и прокариотах (Mora et al., 2003a; Shaw and Green, 2007; Zavialov et al., 2002), появление летального фенотипа дрожжей in vivo (Song et al., 2000).

Так, например, мутанты GAQ RF1 и RF2 были на 4-5 порядков менее эффективны в терминационной реакции, чем белки дикого типа, в то время как их способность связываться с рибосомой не изменялась (Zavialov et al., 2002). Замены любого из двух глицинов мотива GGQ в eRF1 человека приводили к полной потере способности фактора вызвать гидролиз пептидил-тРНК, и также, как и в случае с прокариотами, не влияли на способность фактора связываться с рибосомой (Frolova et al., 1999). У дрожжей in vivo летальными были замены любого из аминокислотных остатков GGQ (Song et al., 2000).

До сих пор не выяснено какая роль в реакции гидролиза пептидилтРНК принадлежит каждому из аминокислотных остатков трипептида GGQ.

Предполагают, что наличие двух глицинов подряд обеспечивает поддержание специфической структуры петли, что в свою очередь важно для правильного позиционирования фактора в ПТЦ (Shaw and Green, 2007;

Trobro and Aqvist, 2007). Конформация глутамина, согласно полученной Drosophila melanogaster (166) REVLHKFTVDLPKKHGRGGQSALRFARLRM Dictyostelium discoideum (168) RTVLHKITVDLPKKHGRGGQSALRFARLRM Arabidipsis thaliana (164) REVLHKFTVDLPKKHGRGGQSALRFARLRM Caenorhabditis elegans (174) REVLHKFTVDLPKKHGRGGQSAVRFARLRN Saccharomyces cerevisae (163) RTVLHKFTVDLPKKHGRGGQSALRFARLRE Podospora ansernia (167) RDIVHKFSVDLPKKHGRGGQSALRFARLRE Schizosaccharomyces pombe (163) REVLQRFTVDLPKKHGRGGQSALRFARLRD Plasmodium falciparum (162) REVIRRFTVDLPKKHGRGGQSALRFARLRL Paramecium tetraurelia (167) KQIIKSFDVDLPKKHNKGGQSSVRFARLRM Giardia intestinalis (171) RTILDRSTVDLPKKHGRGGQSSVRFARLRE Trypanosoma brucei (167) KEKLSSFTVELPKKHGRGGQSKNRFARIRM Tetrahymena thermophila (165) KTVLNKFSVELPKKHGRGGQSSVRFARLRV Oxytricha trifallax (171) REILQKITVELPKKHRKGGQSSVRFARLRE Stylonychia mytilus (171) REILQKITVELPKKHRKGGQSSVRFARLRE Stylonychia lemnae (171) REILQKITVELPKKHRKGGQSSVRFARLRE Euplotes aediculatus (162) RRVIHFITVSLPKKHGRGGQSAPRFGRIRE Blepharisma americanum (166) KEVLHKFSVDLPKKHRRGGQSALRFARLRM RF2 Salmonella typhimurium (238) DLRIDVYRASGAGGQHVNRTESAVRITHI RF2 Escherichia coli (238) DLRIDVYRTSGAGGQHVNRTESAVRITHI RF2 Haemophilus influenzae (238) DLRIDVYRASGAGGQHVNKTESAVRITHM RF2 Bacillus subtilis (237) DIKVDTYRASGAGGQHVNTTDSAVRITHL RF1 Haemophilus influenzae (222) DLRIDTYRSSGAGGQHVNTTDSAVRITHI RF1 Mycoplasma pneumoniae (222) DLRVDTYRASGAGGQHVNRTESAVRITHL RF Mycoplasma capricolum (223) DLRIDTYRASGAGGQHVNTTDSAVRITHL RF1 Pseudomonas aeruginosa (223) DLRVDTYRSSGAGGQHVNKTDSAVRITHI RF2 Staphylococcus aureus (238) DITVDTFRASGAGGQHINKTESAIRITHH RF2 Rhodopirellula baltica (196) DVREDTYRASGAGGQHVNKTDSAIRLTHI RF2 Yersinia pestis (239) DLRIDVYRASGAGGQHVNKTESAVRITHI RF2 Yersinia enterocolitica (238) DLRIDVYRASGAGGQHVNKTESAVRITHI RF2 Ehrlichia ruminantium (122) DLRIDTYRASGAGGQHVNKTESAVRITHI RF1 Rhodopirellula baltica (223) DYRKDFFGASGPGGQHVNKTDSAVRLTHH RF1 Staphylococcus aureus (219) DLKIDTYRSSGAGGQHVNTTDSAVRITHL RF1 Yersinia pestis (221) DLRIDTFRSSGAGGQHVNTTDSAIRITHI RF2 Lactobacillus delbrueckii (237) DLRIDVYRSSGAGGQHINKTSSAVRITHI RF1 Salmonella enterica (221) DLRIDTFRSSGAGGQHVNTTDSAIRITHL RF2 Rodococcus sp. (235) DVRVDVYRSSGPGGQSVNTTDSAVRLTHI RF1 Ehrlichia ruminantium (221) DLRIDVYRSSGPGGQSVNTTDSAVRITHI RF1 Bacillus subtilis (219) DIRVDTFASSGPGGQSVNTTMSAVRLTHL RF1 Mycoplasma pulmonis (224) DLKIDTFRSSGAGGQSVNTTDSAVRITHI RF2 Corynebacterium diphtheriae (235) EVRVDVYRSSGPGGQSVNTTDSAVRLTHI RF1 Tropheryma whipplei (217) EIRIDVFRSSGPGGQSVNTTDSAVRITHL RF1 Mycobacterium leprae (226) DLRIDVYRSSGKGGQGVNTTDSAVRITHL RF1 Rodococcus sp. (224) DLRIDVYRSSGKGGQGVNTTDSAVRITHL RF1 Corynebacterium diphtheriae (221) DLRVDVYRSSGKGGQGVNTTDSAVRITHL RF1 Clostridium perfringens (220) DIKIDVFRASGNGGQCVNTTDSAVRITHL RF1 Clostridium botulinum (219) DLRIDVYRASGHGGQCVNTTDSAVRITHL RF1 Streptococcus mutans (222) DLRVDIYHASGAGGQNVNKVATAVRIIHL RF2 Streptococcus mutans (196) DIKMDTFRSGGAGGQNVNKVSTGVRLTHI последовательностей минидомена GGQ эукариотических (А) и прокариотических (Б) факторов терминации трансляции. Белым на черном фоне выделены абсолютно консервативные аминокислотные остатки, черным на сером фоне выделены полукончервативные аминокислотные остатки.

кристаллической структуре eRF1 человека, стабилизируется формированием ряда водородных связей с другими консервативными аминокислотными остатками минидомена GGQ (Song et al., 2000). Атомы боковой цепи Gln (нумерация соответствует eRF1 человека) образуют водородные связи с гуанидиновой группой Arg189, атомы основной цепи которого, в свою очередь, формируют водородную связь с гидроксильной группой Ser186.

Song et al. (2000) предположили, что глутамин мотива GGQ выполняет функцию координации молекулы воды в ПТЦ для гидролиза пептидил-тРНК.

Это предположение, однако, не подтвердилось в последующих опытах in vitro с использованием мутантных форм eRF1 человека. В экспериментах, проведенных Seit-Nebi et al. (2001), замена Gln185 на глицин или аргинин приводила к снижению RF-активности лишь на 50%. Авторы предположили, что роль Gln185 заключается в поддержании пространственной структуры минидомена. Позже было обнаружено, что большинство замен глутамина мотива GGQ прокариотических факторов RF1 и RF2 также не приводят к полной потере RF-активности фактора in vitro (Mora et al., 2003a; Shaw and Green, 2007). Однако, следует отметить, что in vivo RF1 и RF2, содержащие замены глутамина в GGQ-мотиве, оказались неспособны компенсировать соответствующие термочувствительные мутанты (Mora et al., 2003a). Таким образом, в исследованиях in vivo любые замены глутамина в мотиве GGQ как прокариотических (Mora et al., 2003a), так и эукариотических RF 1-го класса (Song et al., 2000) оказываются летальными. В чем причина расхождения результатов in vivo и in vitro пока остается невыясненным.

Было обнаружено, что остаток глутамина в составе мотива GGQ метилирован в положении N5 в факторах RF1 и RF2 E. сoli (Dincbas-Renqvist et al., 2000), в eRF1 S. cerevisae (Heurgue-Hamard et al., 2005) и в факторе Mrf1p дрожжевых митохондрий (Polevoda et al., 2006), и это метилирование важно для поддержания RF-активности. Метилтрансфераза, ответственная за метилирование RF 1-го класса у E. coli, кодируется геном hemK, расположенным по ходу транскрипции гена prfA, кодирующего фактор RF (Heurgue-Hamard et al., 2002; Nakahigashi et al., 2002). В цитоплазме S.

сerevisae метилирование глутамина мотива GGQ eRF1 осуществляет белок YDR140w (Heurgue-Hamard et al., 2005). Интересно, что HemK и YDR140w практически не имеют сходства в первичной структуре. Кроме того, выявлено, что для метилирования eRF1 S. cerevisae необходимо присутствие eRF3 (Heurgue-Hamard et al., 2005). Возможно, связывание с eRF3 вызывает такие конформационные перестройки в eRF1, в результате которых глутамин мотива GGQ становится доступным для действия метилтрансферазы.

Известно, что метилглутамин в клетках встречается очень редко. К настоящему моменту, помимо RF 1-го класса, описан только один случай такой модификации. Это метилирование Gln150 в рибосомальном белке L E. coli (Lhoest and Colson, 1977), которое, как предполагают, важно для правильной сборки рибосомы. Какую функциональную роль играет метилирование глутамина мотива GGQ до сих пор не выяснено.

В недавнем исследовании, проведенном Shaw and Green (2007), изучалась селективность реакции гидролиза пептидил-тРНК к молекуле воды как нуклеофилу. В качестве конкурентного нуклеофила авторами использовался гидроксиламин. Было установлено, что реакция гидролиза связавшейся с рибосомой пептидил-тРНК может идти с участием других нуклеофилов, однако, в случае, если в А-сайте находиться RF1, реакция становиться селективной к молекуле воды. По-видимому, в результате взаимодействия RF 1-го класса с рибосомой другие нуклеофилы, помимо воды, не могут участвовать в реакции гидролиза. Возможно, это происходит по причине стерического конфликта с нуклеофилами превышающими воду по размерам, либо в результате специфических взаимодействий с молекулой воды. Интересно, что некоторые замены глутамина мотива GGQ вызывали явное снижение селективности к воде. Мутанты GGG, GGA и GGS, хотя и оказывали лишь умеренное влияние на уровень гидролиза пептидил-тРНК in vitro, приводили к существенному повышению уровня аминолиза под действием гидроксиламина. В то же время, такие мутанты как GGW, GGK и GGL, сохраняющие RF-активность, не вызывали снижения селективности реакции. Авторы считают, что это объясняется наличием у триптофана, лизина и лейцина длинных боковых цепей, сходных по размеру с боковой цепью метилированного глутамина, которые формируют своего рода «карман» для молекулы воды. На основании полученных результатов авторы высказали предположение о том, что функциональная роль RF 1-го класса в гидролизе пептидил-тРНК складывается из двух компонентов. Во-первых, он индуцирует конформационные перестройки в ПТЦ для оптимального позиционирования сложноэфирной связи пептидил-тРНК. Во-вторых, он контролирует специфичность реакции, не допуская участия в ней какоголибо другого нуклеофила, помимо воды.

Суммируя все вышесказанное, необходимо отметить, что к настоящему моменту не предложено достоверной модели катализа реакции гидролиза пептидил-тРНК в рибосоме. До сих пор не достигнута определенность в вопросе о том, кто является непосредственным катализатором реакции и какова роль каждого аминокислотного остатка минидомена GGQ RF 1-го класса в этом процессе. Очевидно, что механизм реакции RF-зависимого гидролиза пептидил-тРНК требует дальнейшего изучения.

Глава 2. МАТЕРИАЛЫ И МЕТОДЫ ИССЛЕДОВАНИЙ Штаммы бактерий и плазмиды, использованные в работе, представлены в табл. 2.1.

Таблица 2.1. Бактериальные штаммы и плазмиды плазмиды E.coli:

Плазмиды:

pET23b(+) pUBS pET23b(+), содержащая последовательность (Seit-Nebi et al., 2002) pET23b(+), содержащая последовательность pET23b(+), содержащая последовательность pERF4bAGQ гена мутантной формы G183A eRF1 человека (Seit-Nebi et al., 2001) pET23b(+), содержащая последовательность pERF4bM-AGQ гена мутантной формы G183A М-домена eRF1 (Дубовая et al., 2006) Для выращивания бактерий E. coli использовали полноценную среду LB, содержащую (г/л): дрожжевой экстракт – 5, бакто-триптон – 10, NaCl – 10.

Для получения агаризованных сред добавляли агар до концентрации 1.5%.

Концентрация антибиотиков в среде составляла (мкг/мл): ампициллина (Ap) – 100 и канамицина (Km) – 40.

бактерии E. coli выращивали на минимальной среде М9. Для приготовления л минимальной среды М9 в воде растворяли 6 г Na2HPO4, 3 г KH2PO4, 0.5 г NaCl и 1 г NH4Cl, доводили pH до 7.4 и автоклавировали. После этого в среду добавляли MgSO4 до конечной концентрации 1мМ, CaCl2 до конечной концентрации 0,1 мМ, тиамин до конечной концентрации 1 мМ и C6H12O до конечной концентрации 0,4%. Концентрация антибиотиков в среде составляла (мкг/мл): ампициллина (Ap) – 100 и канамицина (Km) – 40.

В работе использовали реактивы следующих фирм: триптон, дрожжевой экстракт, агар – "Difco"(США); агароза, Triton X-100, – "Sigma" (США);

акриламид и метиленбисакриламид, бромистый этидий, IPTG, ЭДТА, SDS, полинуклеотидов – стандартов молекулярных весов для электрофореза ДНК, гликоген – "Fermentas" (Литва); трис, ацетаты калия, аммония и натрия, имидазол – "Merck" (Германия); персульфат аммония и ТЕМЕD "Bio-Rad" (США); глицерин – "ICN" (США), -меркаптоэтанол – фирмы "FERAK" (Германия); набор белков-стандартов молекулярных весов для белкового электрофореза "New England Biolabs" (США); смола для металл-аффинной хроматографии – "Ni-NTA Superflow" фирмы "Qiagen" (Германия). 15NH4Cl и C6H12O6 – "Cambridge Isotope Laboratory" (США).

использованные в работе реактивы были отечественного производства квалификации о.с.ч.

40S и 60S субъеденицы рибосом из ретикулоцитов кролика были любезно предоставлены Еленой Алкалаевой (Институт Молекулярной Биологии им. Энгельгардта РАН, Москва).

В работе использовали следующие ферменты: эндонуклеазы рестрикции –Bst98I, NdeI, XhoI фирм "Fermentas", "Promega" и "New England Biolabs";

ДНК-полимеразы: Taq – "Fermentas", HiFi – "Sileks, Pfu Turbo - "Stratagene" (США). ДНК-лигаза фага T4 и РНКаза А фирмы "Fermentas".

В работе использовали олигодезоксирибонуклеотиды, синтезированные использованных олигодезоксирибонуклеотидов приведена ниже:

eRFNde 5'-GAGATATACATATGGCGGACGACCC-3' eRFBst 5'-CCATTCTTAAGCGGGCAAAACGCAAGG-3' eRFXho: 5’-GTGGTGCTCGAGGTAGTCATCAAGGTC-3' K178A 5’-TGGATCTCCCAGCTAAACACGGTA-3’ K178I 5’-TGGATCTCCCAATTAAACACGGTA-3’ K178R 5’-TGGATCTCCCACGAAAACACGGTA-3’ K178D 5'-TGGATCTCCCAGATAAACACGGTA-3' K179A 5'-CTCCCAAAGGCACACGGTAGAGGAGG-3' K179R 5'-CTCCCAAAGCGCCACGGTAGAGGAGG-3' K179I 5'-CTCCCAAAGATTCACGGTAGAGGAGG-3' K178A+K179A 5'-TGGATCTCCCAGCTGCACACGGTAGAG-3' H180D 5’-TCCCAAAGAAAGATGGTAGAGGAGGT-3’ H180E 5’-TCCCAAAGAAAGAAGGTAGAGGAGGT-3’ H180S 5’-TCCCAAAGAAATCCGGTAGAGGAGGT-3’ H180A 5'-CTCCCAAAGAAAGCCGGTAGAGGAGG-3' H180R 5'-CTCCCAAAGAAACGCGGTAGAGGAGG-3' H180I 5'-CTCCCAAAGAAAATCGGTAGAGGAGG-3' G181R 5’-AAGAAACACCGTAGAGGAGGTCAGT-3’ G181S 5’-AAGAAACACAGTAGAGGAGGTCAGT-3’ G183S 5'-ACACGGTAGAAGTGGTCAGTCAGC-3' G183R 5'-ACACGGTAGACGTGGTCAGTCAGC-3' G184A 5’-AACACGGTAGAGGAGCTCAGTCAGCCT-3’ G184S 5’-AACACGGTAGAGGAAGTCAGTCAGCCT-3’ G184L 5'-CGGTAGAGGACTTCAGTCAGCCT-3' Q185R 5'-CCATTCTTAAGCGGGCAAAACGCAAGGCTGA Q185E 5'-CCATTCTTAAGCGGGCAAAACGCAAGGCTGA Q185I 5'-CCATTCTTAAGCGGGCAAAACGCAAGGCTGA

AATACCTCC

Q185G: 5’-CCATTCTTAAGCGGGCAAAACGCAAGGCTGA Q185N: 5’-CCATTCTTAAGCGGGCAAAACGCAAGGCTGA S186H 5’-AGGAGGTCAGCATGCCTTGCGTTTTGCCCG S186T 5’-CCATTCTTAAGCGGGCAAAACGCAAGGCTG S186A 5'-CCATTCTTAAGCGGGCAAAACGCAAGGCTG S186L 5’-CCATTCTTAAGCGGGCAAAACGCAAGGCTC R189A: 5'-CCATTCTTAAGCGGGCAAAAGCCAAGGCTG-3' R189K: 5'-CCATTCTTAAGCGGGCAAACTTCAAGGCTG-3' R189Q: 5'-CCATTCTTAAGCGGGCAAACTGCAAGGCTG-3' Плазмидную ДНК выделяли по методу Бирнбойма (Birnboim, 1983) с модификациями. Бактериальные клетки из 3 мл культуры E. coli, выращенной до ранней стационарной фазы роста в среде с соответствующим антибиотиком, собирали центрифугированием. Осадок суспендировали в мкл раствора, содержащего 25 мМ трис-HCl, рН 8.0, 10 мМ ЭДТА, мкг/мл РНКазы А. К суспензии добавляли равный объем раствора, инкубировали 5 мин при комнатной температуре. Затем к смеси добавляли 300 мкл 3 М ацетата калия, рН 5.2, осторожно перемешивали и выдерживали во льду в течение 5 мин. Осветленный лизат, полученный после центрифугирования смеси, переносили в другие пробирки и депротеинизировали фенолом, насыщенным трис-HCl, рН 8.0, и смесью изопропилового спирта. После отмывки 70% и 96% этанолом препарат ДНК растворяли в 50 мкл воды.

Анализ рестрикционных фрагментов ДНК и плазмид проводили в 0.7-1% агарозных гелях в горизонтальных (8-12 см2) блоках при напряженности электрического поля не более 5 В/см. В качестве электрофоретического буфера использовали трис-ацетатный буфер (0.04 М трис-ацетат, 0.002 М ЭДТА, pH 8.0). После электрофоретического разделения ДНК гель окрашивали бромистым этидием и визуализировали в проходящем УФ-свете.

2.2.3. Расщепление ДНК эндонуклеазами рестрикции и стандартными методами, описанным в руководстве Сэмбрука с соавт.

(Sambrook et al., 1989), при оптимальной для каждого фермента температуре инкубации и составе буфера, рекомендованных фирмой-изготовителем.

линеаризованными соответствующими эндонуклеазами рестрикции, проводили при 16оС в течение 14 часов в буфере для ДНК-лигазы фага Т4 ( мМ трис-HCl, pH 7.8; 10 мМ MgCl2; 10 мМ ДТТ; 1 мМ АТФ; 25 мг/мл БСА).

По окончании реакции лигазу инактивировали инкубацией смеси в течение 20 мин при 65оС.

Трансформацию бактерий E. coli проводили по методу Манделя и Хига (Mandel and Higa, 1970) c модификациями. Для получения компетентных клеток в пробирку с 5 мл среды LB вносили 100 мкл ночной культуры.

Клетки выращивали при 37оС с аэрацией до достижения оптической плотности ОD600=0.6. Культуру охлаждали во льду в течение 5 мин. После суспендировали в 1 мл охлажденного во льду стерильного раствора, содержащего 50 мM CaCl2, 10 мM трис-HCl, pH 8.0. Суспензию клеток помещали в ледяную баню на 30 мин, осаждали центрифугированием при 4оС и суспендировали в 200 мкл охлажденного во льду стерильного раствора 50 мM CaCl2, 10 мM трис-HCl, pH 8.0. К полученным компетентным клеткам добавляли ДНК в лигазном буфере или в воде. Смесь инкубировали в ледяной бане в течение 30 мин и затем подвергали тепловому шоку при 42оС (2 мин.). К клеткам добавляли 800 мкл среды LB и инкубировали 1 час при 37оС. Трансформирующую смесь высевали на соответствующие селективные среды и выращивали при 37оС.

ПЦР проводили на приборе MyCycler фирмы "Bio-Rad" (США) в 50 мкл смеси, содержащей однократный буфер для соответствующей ДНКполимеразы, рекомендованный фирмой-поставщиком, 240 мкМ каждого дезоксирибонуклеозидтрифосфата, 0.4 мкМ 5'- и 3'-концевых праймеров, 10нг матричной ДНК, ед. акт. ДНК-полимеразы. После предварительной денатурации при 95оС в течение 3 мин следовали циклов: денатурация – 95оС, 30 сек.; отжиг – 30 сек. при температуре, рассчитанной для каждого из пары используемых в данной реакции 5'- и 3'концевых праймеров с помощью компьютерной программы "Omiga 2.0" (Oxford Molecular Ltd.); синтез – 72оС, от 30 сек. до 2 мин. в зависимости от длины амплифицируемого фрагмента ДНК.

2.2.6. Сайт-направленный мутагенез методом "мегапраймера" Сайт-направленный мутагенез методом "мегапраймера" (Sarkar and Sommer, 1990) проводили в две стадии. На первой стадии проводили ПЦР с помощью праймера, комлементарного 5'-концу гена, и 3'-концевого "мутагенного" праймера, несущего требуемую замену нуклеотидов. При этом использовали в следующей стадии в качестве "мегапраймера". На второй стадии проводили ПЦР с использованием праймера, комплементраного 3’концу гена и имеющего уникальный сайт для рестриктазы, и полученного проведения ПЦР полученный фрагмент ДНК очищали, последовательно обрабатывали соответствующими рестриктазами и лигировали с заранее подготовленным вектором, обработанным теми же рестриктазами. После трансформации клеток E. coli лигированной смесью отбирали отдельные клоны, выделяли плазмидную ДНК и подтверждали присутствие требуемой замены секвенированием.

2.2.7. Очистка фрагментов ДНК в легкоплавкой агарозе После электрофореза агарозный гель (0.8-1,5 %) окрашивали раствором бромистого этидия для визуализации фрагментов ДНК. Нужную полосу вырезали из геля скальпелем под УФ-светом ( = 320 нм) и помещали в пробирку. Выделение фрагментов ДНК из геля проводили с помощью набора фирмы «GE Healthcare» (Великобритания) согласно прилагаемой методике.

2.2.8. Сверхэкспрессия в E. coli и выделение мутантных форм eRF Для экспрессии генов факторов терминации трансляции эукариот использовали конструкцию на основе вектора pEТ23b(+) и штамм E. сoli BL21(DE3)pUBS520. Для препаративного выделения белков к 100-200 мл культуры E. coli, выращенной до ОD600=0.5 при 37оС с аэрацией на среде LB, содержащей соответствующие антибиотики, добавляли IPTG до конечной концетрации 0.1-1мМ, и растили культуру еще 4 – 16 часов с аэрацией при температуре от 18 до 25оС. Клетки собирали центрифугированием при g, осадок ресуспендировали в 10 мл раствора, содержащего 50 мМ трис-HCl, pH 7,5, 100 мМ KCl, 1% Triton X-100, 10% глицерин, 1 мг лизоцима, 0.1 мМ PMSF. Лизат выдерживали во льду 30 мин, после чего клетки разрушали ультразвуком на приборе Sonifier 250 фирмы "Branson" в течение 2 мин при 50% мощности импульсов. Лизат центрифугировали при 8000g 30 мин при 4°С. К супернатанту добавляли 300 мкл 50% суспензии смолы Ni-NTA Superflow, уравновешенной буфером "W" (50 мМ трис-HCl, рН 7.5, 100 мМ KCl, 10% глицерин, 5 мМ -меркаптоэтанол, 10 мМ имидазол). Раствор со смолой перемешивали при комнатной температуре в течение 30 мин и переносили в колонку со стеклянным фильтром. Смолу с адсорбированным белком промывали 3 раза 10 мл буфера "W". Элюцию белка проводили 3 раза по 0.5 мл буфера "W", содержащим 100 мМ имидазола. Присутствие белка во фракциях определяли на спектрофотометре по поглощению при 280 нм.

Фракции, содержащие белок, диализовали против буфера, содержащего мМ трис-HCl, рН 7.5, 100 мМ KCl, 5 мМ -меркаптоэтанола и 5% глицерин, 12 час при 4оС. Белок дочищали с помощью ионообменной хроматографии, Диализованные фракции наносили на колонку HiTrap HP SP объемом 1 мл («GE Healthcare», Великобритания). Введение раствора белка в колонку проводили в буфере «А» (50 мМ трис-HCl, pH 7.5, 5 мМ -меркаптоэтанол, 100 мМ KCl, 5% глицерин) при скорости потока 1 мл/мин. Перед введением колонку уравновешивали буфером «А». Белок элюировали линейным градиентом KCl от 100 мМ до 1 M в буфере «А» объемом 20 мл и собирали фракции по 1 мл. Скорость потока при элюции составляла 1 мл/мин.

Пиковые фракции диализовали против буфера, содержащего 50 мМ трисHCl, рН 7.5, 100 мМ KCl, и 0,1 мМ ЭДТА, 12 час при +40С. Чистоту белка определяли электрофорезом в денатурирующем 12% ПААГ с 0.1% SDS.

Диализованный белок хранили замороженым при –70°С. Концентрацию белка определяли по поглощению в УФ.

2.2.9. Сверхэкспрессия в E. coli и выделение изолированного М-домена eRF1 человека и его мутантной формы G183A, меченных стабильными Для экспрессии генов М-домена и его мутантной формы G183A фактора терминации трансляции eRF1 использовали конструкцию на основе вектора pEТ23b(+) и штамм E. сoli BL21(DE3)pUBS520. Для получения белков, меченных стабильными изотопами 15N и/или 13С, клетки E. coli выращивали на минимальной среде М9, в которой в качестве единственного источника азота был использован NH4Cl и/или в качестве единственного источника углерода была использована глюкоза C6H12O6. Для препаративного получения белка 1 мл культуры E. coli выращенной на среде LB до ОD600= переносили в 50 мл среды М9 и растили 12 часов при 37°С с аэрацией.

Клетки собирали центрифугированием при 1500 g, переносили в 1 л среды М9 и растили еще 4-6 часов при 37°С с аэрацией до ОD600=1. Затем добавляли IPTG до конечной концетрации 1мМ, и растили культуру еще центрифугированием при 4500 g, осадок ресуспендировали в 50 мл раствора, содержащего 25 мМ калий-фосфатного буфера, pH 6,9, 100 мМ NaCl, 1% Triton X-100, 1 мг лизоцима, 0.1 мМ PMSF. Лизат выдерживали во льду мин, после чего клетки разрушали ультразвуком на приборе Sonifier фирмы "Branson" в течение 2 мин при 50% мощности импульсов. Лизат центрифугировали при 8000g 30 мин при 4°С. К супернатанту добавляли мкл 50% суспензии смолы Ni-NTA Superflow, уравновешенной буфером "W" (25 мМ калий-фосфатный буфер, рН 6.9, 100 мМ NaCl, 5 мМ меркаптоэтанол, 10 мМ имидазол). Раствор со смолой перемешивали при комнатной температуре в течение 30 мин и переносили в колонку со стеклянным фильтром. Смолу с адсорбированным белком промывали 3 раза 10 мл буфера "W". Элюцию белка проводили 3 раза по 0.5 мл буфера "W", содержащим 100 мМ имидазола. Присутствие белка во фракциях определяли на спектрофотометре по поглощению при 280 нм. Фракции, содержащие белок, диализовали против буфера, содержащего 20 мМ калий-фосфатного буфера, pH 6,9, 50 мМ NaCl, 5 мМ -меркаптоэтанола, 12 час при 4оС. Белок дочищали с помощью ионообменной хроматографии, используя систему AKTA («GE Healthcare», наносили на колонку HiTrap HP SP объемом 1 мл («GE Healthcare», Великобритания). Введение раствора белка в колонку проводили в буфере «А» (20 мМ калий-фосфатный буфер, рН 6.9, 5 мМ -меркаптоэтанол, 50 мМ уравновешивали буфером «А». Белок элюировали линейным градиентом NaCl от 50 мМ до 1 M в буфере «А» объемом 20 мл и собирали фракции по мл. Скорость потока при элюции составляла 1 мл/мин. Пиковые фракции диализовали против буфера, содержащего 20 мМ калий-фосфатный буфера, рН 6.9, 1 мМ -меркаптоэтанол, 100 мМ NaCl, 12 час при +40С. Чистоту белка определяли электрофорезом в денатурирующем 12% ПААГ с 0.1% SDS. Диализованный белок хранили замороженым при –70°С. Концентрацию белка определяли по поглощению в УФ.

2.2.10. Электрофорез белков в денатурирующем 12% ПААГ Чистоту выделенных белков анализировали в 12% ПААГ, содержащим 0.1% SDS. В качестве электрофоретического буфера использовали трисглициновый буфер с SDS (25 мМ трис, 250 мМ глицин и 0.1% SDS, pH 8.3).

Образцы наносили на гель в буфере, содержащим 50 мМ трис-HCl, pH 6.8, 100 мМ -меркаптоэтанола, 1% SDS, 0.01% бромфеноловый синий и 20% глицерина, предварительно выдержав на водяной бане 5 мин при 100°С.

После электрофоретического разделения белков гель окрашивали раствором 0.25% Кумаси синего R250 и визуализировали в белом свете.

Спектры ЯМР были измерены В.И. Польшаковым (Центр магнитной томографии и спектроскопии МГУ, Москва) и Б. Бирдсалл (Национальный институт медицинских исследований, Лондон) на спектрометрах Varian INOVA 600 МГц и 800 МГц и Bruker Avance 600 МГц, оборудованных криодатчиками тройного резонанса для регистрации резонанса ядер 1H и возбуждения ядер Nи C. Измерения проводились на образцах М-домена eRF1 человека и его мутантной формы G183A объемом 300-600 мкл и концентрацией белка в растворе 0.5-0.8 мМ. Для измерения спектров ЯМР использовали раствор, содержащий 20 мМ калий-фосфатного буфера при pH 7.0 и 50 мМ NaCl. Были измерены следующие двумерные (2D) и трехмерные (3D) спектры ЯМР при температурах 5С и 25С: 2D DQF-COSY, NOESY, TOCSY, [15N,1H] HSQC, [13C,1H] HSQC, 3D [15N,1H] HSQC-NOESY, [13C,1H] NOESY-HSQC, [13C,1H] HSQC-NOESY, HCCH-TOCSY, HNHA, HNHB, HBHA(CO)NH. Преобразование спектров ЯМР осуществляли с помощью программного пакета nmrPipe (Delaglio et al., 1995). Для визуализации и анализа спектров ЯМР использовали программы nmrDraw (Delaglio et al., http://www.cgl.ucsf.edu/home/sparky).

сигналов основной цепи были использованы следующие спектры: HNCO, HNCA, HN(CO)CA, HNCACB, CBCA(CO)NH, HNHAHB и HBHA(CO)NH (Bax and Grzesiek, 1993). Отнесения для алифатических боковых цепей были получены из спектров 3D HCCH-TOCSY, HNHB, [15N,1H] NOESY-HSQC и [13C,1H] NOESY-HSQC. Ограничения на межъядерные расстояния были получены из анализа 3D спектров 25С и 5С. Для определения ориентационных ограничений были измерены остаточные константы диполь-дипольного взаимодействия (ОКДДВ) 1DNH между ядрами 15N и 1H амидных групп белка в разбавленных (5%) растворах пентаэтиленгликоля (C8E5) с октанолом ((Ruckert and Otting, 2000). В указанных анизотропных средах остаточные квадрупольные расщепления ядер дейтерия составляли 28 и 27 Гц при 25 и 10оС соответственно.

Величины 1DNH были определены из 2D спектров IPAP-HSQC (Ottiger et al., 1998) путем вычитания величин расщепления сигналов 15N-1H, измеренных в анизотропных и изотропных средах.

(http://www.cgl.ucsf.edu/home/sparky) на графических станциях SGI Octane2 и Octane в Центре магнитной томографии и спектроскопии МГУ (Москва).

После интегрирования кросс-пиков ядерного эффекта Оверхаузера (ЯЭО) соответствующие протон-протонные межъядерные расстояния были сгруппированы в 4 подгруппы с верхними пределами 2.5, 3.5, 4.5 and 5.5. Допустимые пределы диэдральных углов и были получены из Стереоспецифическое отнесение сигналов H и pro-R/pro-S метильных групп аминокислотных остатков Val и Leu вместе с ограничениями на диэдральные углы 1 были получены с помощью программы AngleSearch (Polshakov et al., 1995).

Для расчета начальной структуры белка однозначно определенные ЯЭО были использованы в качестве исходной группы экспериментальных ограничений в итерационной процедуре (Nilges et al., 1997) с использованием программного пакета ARIA-CNS (Linge et al., 2003). Расчет структуры выполнялся с помощью метода молекулярной динамики с наложенными экспериментальными ограничениями. После получения семейства начальных структур было проведено их уточнение, для чего были добавлены дистанционные ограничения, соответствующие внутримолекулярным водородным связям и ориентационные ограничения, полученные из величин остаточных констант диполь-дипольного взаимодействия 1DNH. Амидные протоны белка, участвующие в образовании водородных связей, были идентифицированы в спектрах NOESY после растворения белка в D2O.

Акцепторы соответствующих водородных связей были определены из числа близко расположенных карбонильных групп в семействе начальных структур. Были использованы по два дистанционных ограничения для каждой водородной связи: rNH···O 2.4 и 2.4 rN···O 3.4. На заключительной стадии определения структуры белка все экспериментально измеренные ограничения на расстояния, диэдральные углы и 1DNH были использованы в протоколе медленного отжига (simulated annealing protocol) расчета по методу молекулярной динамики с использованием программы XPLOR-NIH (Schwieters et al., 2003). 20 пс траектории молекулярной динамики при 1500К с последующей стадией охлаждения от 1500 до 10К той же длительности (1000 шагов по 0.2 пс) были использованы в протоколе расчета. Лучшие 25 из 50 рассчитанных структур были выбраны с использованием в качестве основного критерия минимума энергии экспериментальных ограничений.

Анализ качества рассчитанных структур выполнен с помощью программ AQUA, PROCHEK-NMR (Laskowski et al., 1996), MolMol (Koradi et al., 1996) и InsightII (Accelrys Software Inc).

Измерения скоростей продольной (спин-решеточной) релаксации R были выполнены в псевдо-3D эксперименте ЯМР с релаксационными задержками 8.6 мс, 24.7 мс, 48.6 мс, 96.9 мс, 193.2 мс, 345.7 мс, 498.2 мс, 594.5 мс, 795.2 мс, 1196.4 мс и 1597.7 мс. Измерения поперечной (спинспиновой) релаксации R2 были проведены в аналогичном эксперименте с релаксационными задержками 8.5 мс, 17.1 мс, 25.6 мс, 34.1 мс, 42.6 мс, 51. мс, 59.7 мс, 68.2 мс, 76.7 мс, 93.8 мс и 119.4 мс. Насыщение ядер 1H в течение 4с было использовано при измерении гетероядерных эффектов Оверхаузера N{1H}. Значения R1 и R2 вместе с их стандартными отклонениями были получены из анализа изменения интегральных интенсивностей сигналов методом нелинейной регрессии. Значения ЯЭО 15N{1H} рассчитаны с учетом уровня фонового шума и проверены с использованием двух измерений экспериментальных данных. Экспериментальные величины релаксационных использованием безмодельного формализма Липари и Сзабо движения молекул (Lipari and Szabo, 1982) с расширением, включающим более медленные внутренние движения (Clore et al., 1990b) и учетом вклада Rex в скорость поперечной релаксации за счет конформационного обмена (Clore et al., 1990a). Все расчеты были выполнены с использованием программы RelaxFit (Polshakov et al., 1999) и TENSOR-2 (Dosset et al., 2000). Величина и параметры аксиально симметричного тензора вращательной диффузии были рассчитаны методом Монте-Карло.

2.2.14. ЯМР-титрование субчастицами рибосом Для титрования 40S и 60S субъединицами рибосом использовали образцы М-домена eRF1, меченного стабильными изотопами 15N, в диапазоне концентраций от 30 до 200 мкM и объемом 600 мкл. Титрование проводили при молярных соотношениях 60S субчастицы рибосом с М-доменом eRF 1:15000, 1:9000, 1:8000, 1:7500, 1:5000, 1:4500, 1:4250, 1:4000, 1:3500, 1: и 1:2000. Титрование проводили как добавляя 60S субчастицы рибосом к образцу М-домена, так и наоборот: добавляя М-домен к 60S. В качестве контроля на специфичность взаимодействия проводили титрование Мдомена 40S субъединицами рибосомы, которые добавляли в молярных соотношениях 40S/М-домен 1:3500, 1:1750. Влияние ионной силы раствора на взаимодействие М-домена с 60S субъединицами оценивали с помощью постепенного увеличения концентрации NaCl в конечной смеси от 50 мМ до 75 мМ. Все спектральные измерения проводили при температурах 25C и 5C. Для мониторинга изменения ширины резонансных линий использовали N-1H HSQC (Bodenhausen and Ruben, 1980). Преобразование спектры спектров ЯМР осуществляли с помощью программного пакета nmrPipe (Delaglio et al., 1995). Для определения интегральной интенсивности сигналов определяли параметры гауссовой формы линии разрешенных сигналов в спектрах HSQC методом нелинейной регрессии с использованием стандартных алгоритмов программы Sparky (Goddard & Kneller, СанФранциско, США; http://www.cgl.ucsf.edu/home/sparky). Для визуализации полученных результатов использовали программы молекулярной графики InsightII (Accelrys, США) и VMD (Humphrey et al., 1996). Для расчета молекулярной поверхности белка, доступной для растворителя, использовали программу InsightII и алгоритм Конноли (Connolly, 1983).

Определение активности мутантных форм eRF1 проводилось Е.З.

Алкалаевой (Институт молекулярной биологии им. Энгельгардта РАН, Москва) с помощью реконструированной системы трансляции in vitro согласно методу описанному Alkalaeva et al. (2006).

3.1. Определение структуры М-домена eRF1 человека в растворе Структура M-домена eRF1 человека в растворе была определена методом ЯМР. Основные этапы работы включали: (а) получение образцов белка, меченного стабильными изотопами 15N и 13C; (б) измерение серии 2D и 3D спектров ЯМР; (в) отнесение сигналов 1H, 13 белка; определение ограничений на межъядерные расстояния, диэдральные углы и пространственную ориентацию химических связей из спектров ЯМР; и (д) расчет семейства структур белка методом молекулярной динамики с использованием указанных экспериментальных ограничений.

Отнесение сигналов было выполнено как для дикой формы белка, так и для функционально неактивного мутанта Gly183Ala. Методы ЯМР были также использованы для определения динамических свойств белковой цепи Mдомена eRF1 в растворе.

3.1.1. Отнесение сигналов атомов основной белковой цепи и боковых цепей аминокислотных остатков M-домена Отнесения были выполнены для всех наблюдаемых сигналов основной цепи М-домена eRF1 человека и более 95% от общего числа сигналов атомов боковых цепей. Для отнесения сигналов была использована стандартная стратегия, основанная на использовании 3D гетероядерных экспериментов ЯМР (см. главу «Материалы и методы»). Следует отметить, что на спектрах, измеренных при температуре 298К, сигналы амидных протонов основной белковой цепи для аминокислотных остатков (а.о.) фрагмента 177-187 (т.е.

петли, содержащей мотив GGQ) отсутствовали. Так, на спектре 15N,1H-HSQC, записанном при 298К, не удалось обнаружить сигналов амидных протонов Gly181, Gly183 и Gly184, вследствие быстрого обмена их амидных протонов с водой. Несмотря на то что, сигналы амидных протонов основной белковой цепи для Gln185 не детектировались, на спектре 15N-HSQC были обнаружены и отнесены сигналы его амидных протонов боковой цепи. Тем не менее, все отсутствующие при 298К сигналы петли 177-187 удалось обнаружить и отнести на спектрах 15N-HSQC, измеренных при температурах 288К и ниже (рис. 3.1). Отнесения сигналов петли 177-187 при температуре 278К были выполнены с помощью 3D спектров HNCA и 15N-NOESY-HSQC.

Рис. 3.1. Область глицинов спекрта 1H, записанного при температуре 278К. Нумерация а.о. соответствует eRF1.

Химические сдвиги 1H, базу данных BioMagResBank (http://www.bmrb.wisc.edu) под кодом BMRBОпределение вторичной и третичной структуры М-домена Анализ спектров ЯМР, измеренных при температурах 278 и 298К, торсионные углы и ориентацию связей N-H (табл. 3.1.). Для этого были применены стандартные методы двойного и тройного резонанса ЯМР с использованием как немеченого препарата М-домена eRF1, так и меченного стабильными изотопами N или межядерные расстояния было получено из спектров NOESY (спектров ядерного эффекта Оверхаузера - ЯЭО), записанных при 298К. Для тех остатков, сигналы которых отсутствовали при этой температуре, а также для некоторых других, претерпевающих быстрые внутримолекулярные движения, ограничения ЯЭО получали из спектров, измеренных при 278К.

Для большинства аминокислотных остатков М-домена количество контактов ЯЭО, приходящееся на один аминокислотный остаток, составляло от 20 до 40. Однако, для остатков участка 178-184 и некоторых других, также находящихся в подвижных петлях, это количество было заметно меньше (см.

рис. 3.2).

Для определения ориентационных ограничений были измерены остаточные константы диполь-дипольного взаимодействия (ОКДДВ) 1DNH между ядрами величин ОКДДВ при 298К, лежащих в диапазоне от -47Гц до +37 Гц, и значение ОКДДВ при 283K в диапазоне от -52 Гц до +38 Гц.

На основе всех полученных данных было рассчитано семейство из структур ЯМР (рис. 3.3.). Из рассчитанных 25 конформеров определена среднеквадратичных отклонений (RMSD) координат тяжелых атомов полипептидной цепи (С, C и N) при суперпозировании на нее всех остальных членов семейства. Величина такого среднеквадратичного отклонения не превышала 0.9.

Рис. 3.2. Гистограмма распределения числа ЯЭО на каждый аминокислотный остаток M-домена eRF1. Синим цветом показаны ЯЭО внутри одного остатка;

бирюзовым – ЯЭО между соседними остатками; желтым – ЯЭО между остатками, удаленными друг от друга по белковой цепи от 2 до 5 а.о.; красным цетом показаны более дальние ЯЭО.

Если исключить из анализа наименее структурированный фрагмент 175-189, значение RMSD координат атомов остальной белковой цепи не превышает 0.4, что соответствует структуре высокого разрешения. На карте Рамачандрана в благоприятной области находится 89,9% аминокислотных остатков всего семейства структур и ни одного остатка в запрещенной области (рис. 3.4). Координаты атомов 25 рассчитанных структур и экспериментальные ограничения, использованные в расчетах были депонированы в банк белковых структур (Protein Data Bank) под кодом 2HST.

Таблица 3.1. Статистические параметры расчета структуры M-домена eRF1.

А. Экспериментальные ограничения, использованные в расчете Б. Нарушения экспериментальных ограничений и статистика для 25 структур Нет ЯЭО или диэдральных углов с нарушениями более 0.2 и 10o соответственно отклонение ограничений карты Рамачандрана Рамачандрана Г. Среднеквадратичное отклонение при суперпозиции рассчитанных структур на репрезентативную структуру () Тяжелые атомы белковой цепи (C, C, N) а.о. 142-275 0.87 ± 0. Тяжелые атомы белковой цепи (C, C, N) белка без подвижной петли 178- Тяжелые атомы белковой цепи (C, C, N) структурного ядра белка (а.о. 142-174, 200-275) S - ансамбль 25 финальных структур; Srep – репрезентативная структура, выбранная из финального семейства стуктур ЯМР на основе критерия минимальной суммы попарных среднеквадратичных отклонений координат тяжелых атомов белка при суперпозированиии на нее остальных структур семейства.

Рис. 3.3. Структура М-домена eRF1 человека в растворе. Стереоизображение семейства 25 рассчитанных структур (показаны красным цветом), суперпозированные по тяжелым атомам основной цепи. При суперпозиции не учитывался плохо структурированный участок петли GGQ (а.о. 175-189). Синим цветом, для сравнения, показана структура М-домена eRF человека в кристалле, суперпозированная на репрезентативную структуру белка в растворе.

Рис. 3.4. Карта Рамачандрана (торсионные углы и основной цепи белка) для всего семейства 25 конформеров М-домена eRF1 человека в растворе. Остатки глицинов показаны в виде треугольников, все остальные аминокислотные остатки – в виде квадратов.

3.1.3. Анализ структуры М-домена eRF1 человека Топология М-домена eRF1 человека представляет собой -ядро, антипараллельными), окруженное четырьмя -спиралями: 1-4 (рис. 3.5).

Лист 3 и наиболее длинная спираль 1 характеризуются наличием резких изгибов в области а.о. 168-169 и 195-196, соответственно. Спираль начинается с С-конца петли GGQ (а.о. 175-189) и ведет к листу 4. Структура содержит несколько петель, самой длинной из которых является GGQ-петля.



Pages:   || 2 | 3 |
 
Похожие работы:

«01Апр Убийство на улице Шляпиной Самое главное событие прошлой недели – убийство молодой женщины на улице Веры Шляпиной. Весна ещё только на старте, а межличностные и межполовые отношения уже приобретают кровавую окраску. Трагедия произошла в ночь с 28 на 29 марта. В час ночи в дежурную часть ОВД от диспетчера станции скорой помощи АЦГБ поступило сообщение о том, что в городе Алапаевске в самом центре находится женщина с ножевым ранением в области спины. Скорее всего, удар такой силы был...»

«Владимир Бубнов Настольная книга Турбо-суслика Практические рекомендации по ведению проработок 1.0 2 | Настольная книга Турбо-суслика Содержание Введение Disclaimer Не начинайте прорабатываться Турбо-сусликом Не перерабатывайтесь Слушайте свое тело Делайте перерывы в проработках Держите в голове цели проработок Ведите дневник изменений Следуйте инструкции, приведенной в книге Запускайте протоколы с вечера Пользуйтесь быстрочиталкой Запускайте Авто-Машку или Авто-Петьку Переходите к платным...»

«ФГУ Научный центр акушерства, гинекологии и перинатологии им. В.И. Кулакова Росмедтехнологий Российская Ассоциация по менопаузе ПРАКТИЧЕСКИЕ РЕКОМЕНДАЦИИ ведение женщин в перии постменопаузе москва 2010 ФГУ Научный центр акушерства, гинекологии и перинатологии им. В.И. Кулакова Росмедтехнологий Российская Ассоциация по менопаузе ПРАКТИЧЕСКИЕ РЕКОМЕНДАЦИИ ведение женщин в пери- и постменопаузе Рабочая группа: Cухих Г.Т., Сметник В.П., Ильина Л.М., Юренева С.В., Коновалова В.Н., Балан В.Е.,...»

«www.kitabxana.net Ruft Milli Virtual Kitabxanann tqdimatnda Azrbaycan xalqlarnn dbiyyat e-antologiyas: Rus v malakanlar dbiyyat N 01-14 (136 - 2013) Rusca yazan v malakanlarn dbiyyat antologiyas АЗЕРБАЙДЖАН В МЕНЯЮЩЕМСЯ МИРЕ (по итогам двух литературных конкурсов) Rusdilli mlliflrin publisistika v poeziya nmunlri (Rus dilind) Virtual redaktoru v e-nr hazrlayan: Aydn Xan (bilov), yazar-kulturoloq 2013 YENI YAZARLAR V SNTILR QURUMU. E-NR N01-14 (136) www.kitabxana.net Milli Virtual Kitabxanann...»

«Читайте Интернетверсию газеты 12+ №3 Рекламноинформационное издание. Приложение к газете Новая Жилплощадь от 26 января 2013 г. РЕЕСТР КОМПАНИЙ, ОПУБЛИКОВАВШИХ ОБЪЯВЛЕНИЯ СВОИХ КЛИЕНТОВ КОММЕРЧЕСКАЯ. ПРОДАЖА КОММЕРЧЕСКАЯ. ПРОДАЖА КОММЕРЧЕСКАЯ. ПРОДАЖА КОММЕРЧЕСКАЯ. АРЕНДА КОММЕРЧЕСКАЯ. АРЕНДА КОММЕРЧЕСКАЯ. АРЕНДА ЗАГОРОДНАЯ. ПРОДАЖА ЗАГОРОДНАЯ. ПРОДАЖА ЗАГОРОДНАЯ. ПРОДАЖА ЖИЛАЯ. ПРОДАЖА ЖИЛАЯ. ПРОДАЖА ЖИЛАЯ. ПРОДАЖА...»

«ПЛЕНАРНЫЕ ДОКЛАДЫ УДК 630*221.0 О ПЕРСПЕКТИВАХ РАЗВИТИЯ ЛЕСНОГО КОМПЛЕКСА ДАЛЬНЕГО ВОСТОКА А.П. КОВАЛЕВ 680030 ХАБАРОВСК, ул. Волочаевская, 71 ФБУ Дальневосточный научно-исследовательский институт лесного хозяйства Приводится характеристика лесного фонда ДФО по показателям доступности для промышленной лесоэксплуатации. Определены основные факторы, способствующие прогрессивному истощению и ухудшению качества лесных ресурсов. Показаны пути выхода из сложившейся ситуации. Развитие и перспективы...»

«ДИСЛОКАЦИЯ войсковых частей, штабов, управлений, учреждений и заведений Рабоче-Крестьянской Красной Армии по состоянию на 1 июля 1935 года Издание 4-го отдела штаба РККА Москва – 1935 г. РГВА, OCR – Евгений Дриг (http://mechcorps.rkka.ru) Версия файла от 29.11.2011 г. © RKKA.RU Примечания: данный файл, в отличии от первоначального источника, содержит сведения только по стрелковым войскам и кавалерии, а также приведены только полки, а отдельные батальоны, роты, дивизионы, эскадроны в составе...»

«Магия – энциклопедия магии и колдовства Виктор Михайлович Кандыба Виктор Михайлович Кандыба Автор в своей книге рассказывает о таинственных и загадочных случаях магии и колдовства с древнейших времен и до наших дней. Книга рекомендуется массовому читателю. ЭКСПЕРИМЕНТАЛЬНАЯ МАГИЯ В результате достаточно подробного знакомства с существующей литературой, а также с немногочисленными научными исследованиями явлений колдовства, волшебства, магии и тому подобного, я пришел к некоторым выводам,...»

«АРВ-препараты СЕРИЯ ДЛЯ ПОЗИТИВНЫХ ЛЮДЕЙ www.hivtri.org.ua Четвертое дополненное издание подготовлено и переиздается ВБО Час Життя Плюс в рамках проекта Кадровый потенциал и качественные услуги как звенья предоставления помощи ЛЖВ в Украине. Издание подготовлено к печати МБФ Международный Альянс по ВИЧ/СПИД в Украине и специалистами ВБО Час Життя Плюс в рамках реализации программы Поддержка с целью профилактики ВИЧ/СПИД, лечения и ухода наиболее уязвимых групп населения в Украине. Продукция...»

«1 БИБЛИОТЕКИ НАЦИОНАЛЬНЫХ АКАДЕМИЙ НАУК: ПРОБЛЕМЫ ФУНКЦИОНИРОВАНИЯ, ТЕНДЕНЦИИ РАЗВИТИЯ Сборник основан в 2000 г. Международная редакционная коллегия А. С. Онищенко, акад. НАН Украины, д-р филос. наук (Украина) – председатель К. К. Абугалиева (Казахстан) А. И. Алиева-Кенгерли, канд. филол. наук (Азербайджан) А. А. Аслитдинова, канд. филос. наук (Таджикистан) Н. Ю. Березкина, канд. ист. наук (Беларусь) В. Н. Горовой, д-р ист. наук (Украина) Л. А. Дубровина, чл.-кор. НАН Украины, д-р ист. наук...»

«Московский государственный университет имени М.В. Ломоносова Факультет вычислительной математики и кибернетики Кафедра автоматизации систем вычислительных комплексов Магистерская диссертация РАЗРАБОТКА СИСТЕМЫ БЮДЖЕТИРОВАНИЯ ДЛЯ ЭЛЕКТРОСЕТЕВЫХ КОМПАНИЙ НА БАЗЕ АНАЛИТИЧЕСКОГО ХРАНИЛИЩА ДАННЫХ Работу выполнил студент Имаев В.М. Научный руководитель: Иевенко М.В. Капитонова А.П. подпись научного руководителя Москва Введение. Постановка задачи Обзор методов решения Методология автоматизации...»

«Управление образования администрации Ковровского района Муниципальное учреждение Информационно-методический центр В.П. Филимонов ИЗ ЖИЗНИ СКАЗКИ (Методические материалы к пропедевтическому курсу для учащихся 1-4 классов) Часть 2 2008 г. 1 Во второй части настоящего пособия учителя найдут подробно разработанные конспекты занятий с учащимися 3-4 классов в рамках экспериментального пропедевтического курса Из жизни сказки и развернутые, по мере необходимости, комментарии к этим занятиям. Занятия в...»

«20 Москва Проводится 18–21 марта 2014 с 1994 года лет Юбилейный Всероссийский Конгресс с международным участием Амбулаторно-поликлиническая помощь – в эпицентре женского здоровья Сборник тезисов Юбилейный Всероссийский Конгресс с международным участием Амбулаторно-поликлиническая помощь – в эпицентре женского здоровья Сборник тезисов М., 2014–383 с. ФГБУ Научный центр акушерства, гинекологии и перинатологии им. академика В.И. Кулакова Минздрава России Российское общество акушеров-гинекологов...»

«ОРГАНИЗАЦИЯ A ОБЪЕДИНЕННЫХ НАЦИЙ ГЕНЕРАЛЬНАЯ АССАМБЛЕЯ Distr. GENERAL A/HRC/WG.6/3/BDI/3 15 September 2008 RUSSIAN Original: ENGLISH СОВЕТ ПО ПРАВАМ ЧЕЛОВЕКА Рабочая группа по универсальному периодическому обзору Третья сессия Женева, 1-15 декабря 2008 года РЕЗЮМЕ, ПОДГОТОВЛЕННОЕ УПРАВЛЕНИЕМ ВЕРХОВНОГО КОМИССАРА ПО ПРАВАМ ЧЕЛОВЕКА В СООТВЕТСТВИИ С ПУНКТОМ 15 С) ПРИЛОЖЕНИЯ К РЕЗОЛЮЦИИ 5/ СОВЕТА ПО ПРАВАМ ЧЕЛОВЕКА Бурунди* Настоящий доклад представляет собой резюме материалов1, направленных...»

«СОЦИАЛЬНАЯ ДИАГНОСТИКА УДК 331.556.4(=161.1):316.334.22 Т.Н. Войлокова ЧЕЛОВЕЧЕСКИЙ КАПИТАЛ ВЫСОКОКВАЛИФИЦИРОВАННЫХ РУССКОЯЗЫЧНЫХ СПЕЦИАЛИСТОВ В ЭМИГРАЦИИ: ТРАЕКТОРИИ ПРОФЕССИОНАЛЬНОГО И КАРЬЕРНОГО РАЗВИТИЯ ИММИГРАНТОВ ЧЕЛОВЕЧЕСКИЙ КАПИТАЛ ВЫ С О КО- HIGHLY SKILLED RUSSIAN-SPEAKING КВ А Л ИФ ИЦ ИР О В А Н НЫ Х РУССКОЯЗЫЧНЫХ PROFESSIONALS: CAREERS OF IMMIGRANTS СПЕЦИАЛИСТОВ В ЭМИГРАЦИИ: ТРАЕКТОРИИ ПРОФЕССИОНАЛЬНОГО И КАРЬЕРНОГО РАЗВИТИЯ ИММИГРАНТОВ ВОЙЛОКОВА Татьяна Николаевна — руководитель...»

«+ 590-002 ЧАСТНЫЕ ОБЪЯВЛЕНИЯ ВТОРНИК с 18.00 до 9.00 объявления принимаются ПО ТЕЛЕФОНУ 22 апреля 2014 г. на автоответчик г. Караганда ГАЗЕТА ЧАСТНЫХ ОБЪЯВЛЕНИЙ НОВЫХ 169 ОБЪЯВЛЕНИЙ И КОММЕРЧЕСКИЕ №16(549) Рекламно - информационное издание ПРЕдЛОжЕНИЙ ОБЪЯВЛЕНИЯ ЧУ Редакция газеты Из рук в руки. Астана (Караганда). ЗА НЕдЕЛю через сервис-службу Казахтелеком Выходит с 2004 г. 1 раз в неделю: вторник. CMYK + ИЗ РУК В РУКИ Частное объявление Вы можете подать по тел.: 590-002, на сайте: www.irr.kz...»

«ОРГАНИЗАЦИЯ ИССЛЕДОВАТЕЛЬСКОЙ ДЕЯТЕЛЬНОСТИ ШКОЛЬНИКОВ Семинар-тренинг для руководителей исследовательских групп,участников городского краеведческого конкурса Мой город. Октябрь 2010 г. Подготовка материала и проведение семинара-тренинга : Никитченко Татьяна Викторовна. Методисто ОТиК ЦДТ г.Владивостока. Теоретические основы организации исследовательской деятельности школьников Основные вопросы -Учебно-исследовательская деятельность -Деятельность, её характерные черты и структура -Понятие...»

«УТВЕРЖДЕН ПРЕДВАРИТЕЛЬНО УТВЕРЖДЕН годовым Общим собранием акционеров Советом директоров Открытого акционерного общества Открытого акционерного общества Группа Черкизово Группа Черкизово Протокол № 30/066а от 12.07.2006 Протокол № 16/056д от 18.05.2006 Председательствующий Председательствующий И.Э. Бабаев И.Э. Бабаев (подпись) (подпись) М.П. М.П. ГОДОВОЙ ОТЧЕТ Открытого акционерного общества Группа Черкизово ПО РЕЗУЛЬТАТАМ ФИНАНСОВО-ХОЗЯЙСТВЕННОЙ ДЕЯТЕЛЬНОСТИ В 2005 ФИНАНСОВОМ ГОДУ г. Москва,...»

«Стрелецкий В.В. Откровения о будущем. Настольная книга начинающего пророка //, Киев, 2007 FB2: “mrholms ” mrholms@mail.ru, 2010-03-08, version 2 UUID: 6DA68A37-674A-4895-BE70-7EF352A600BE PDF: fb2pdf-j.20111230, 13.01.2012 Владимир Васильевич Стрелецкий Откровения о будущем. Настольная книга начинающего пророка Книга содержит оригинальные комментарии к откровениям великих провидцев человечества — Иоанна Богослова, Мишеля Нострадамуса, Иоанна из Иерусалима, Даниила Андреева, Учителей Великого...»

«Пролетарии всех стран, соединяйтесь! Фракция КПРФ была против Карачун украинской души Учёные Приморья - зарплата на 12,5% ниже.7 “Советский Союз” придёт на смену “России”.8 Цифра недели 374 коммуниста состоит на учёте в Еженедельная газета Приморского краевого отделения КПРФ Уссурийском местном отделении КПРФ. № 21 (672) 4 – 10 июня Впрочем, чужих денег губернатору не жалко. В настоящее время продолжается ожесточен- Вместе с тем, увеличение долговой составляНе жалко их на достройку двух...»





Загрузка...



 
© 2014 www.kniga.seluk.ru - «Бесплатная электронная библиотека - Книги, пособия, учебники, издания, публикации»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.